KEGG   Erythrobacter litoralis HTCC2594: ELI_05300Help
Entry
ELI_05300         CDS       T00315                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00630  Glyoxylate and dicarboxylate metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01200  Carbon metabolism
Module
eli_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ELI_05300
Enzymes [BR:eli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ELI_05300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABC63152
UniProt: Q2NAY9
Position
complement(1094387..1095985)
Genome map
AA seq 532 aa AA seqDB search
MTYQQTIAKMNETIASNGAPWDAIDAEAAARMQIQNRFPTGLDIARYTAKIMRDDMKAYD
NDPANYTQSLGCWHGFIAQQKMISIKKHFGSTKRRYLYLSGWMVAALRSEFGPLPDQSMH
EKTSVPALIEELYTFLKQADARELGGLFRELDAAKEASDAVNIHRLQRKIEEHQTHVVPI
IADIDAGFGNAEATYLLAKKMIEAGACALQIENQVSDEKQCGHQDGKVTVPHEDFHQKIR
AIRYAFLELGVPDGIIVARTDSLGAGLTKQIAYTTEEGDLGDQYNAFLDCEEVSPEDMKN
GDVFLSREGKLLRPKRLPSNLFQFREGTGEDRCVLDGITSLQAGADLLWIETEKPHIGQI
GGMVKRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAWKEEGRDLTNYDRARLMDAEYDE
TELAAEADARIQTFQADAAREAGIFHHLITLPTYHTAALSTDNLAKRYFGDEGMLGYVKN
VQREEIRQGIACVKHQNMAGSDIGDDHKEYFAGEAALKAGGADNTMNQFEAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccagcaaaccatcgcgaagatgaacgaaacgatcgccagcaacggcgcacct
tgggatgccatcgatgccgaagcggcagcccggatgcagatccagaaccggtttcccacc
ggcctcgatatcgcgcgttataccgcgaagatcatgcgcgatgacatgaaggcctatgac
aacgaccctgccaattacacccagtcgctgggctgctggcacgggttcatcgcgcaacaa
aagatgatcagcatcaagaagcatttcggcagcaccaagcgccgttatctctatctgtcg
ggctggatggtcgctgcattgcggagcgaattcggacccctgcccgaccagtcgatgcat
gagaagaccagcgttccggccttgatcgaggagctctacactttcctcaaacaggccgat
gcccgcgaactgggcggcctgttccgtgaactcgacgcggcgaaggaagccagcgacgca
gtgaatatccaccgcctgcaacgcaagatcgaagagcaccagacccatgtcgtcccgatc
attgccgatatcgatgccggcttcggcaatgccgaggcgacctacctgctcgccaagaag
atgatcgaagccggtgcctgcgcgctgcagatcgaaaaccaggtttcggacgagaagcag
tgcggccaccaggatggaaaggtcactgtcccgcacgaggacttccaccagaagatccgc
gcgatccgctacgccttcctcgaactgggcgttccggacggcatcatcgttgcacgtacc
gactcgctcggcgcgggcctcaccaagcagatcgcctacacgacggaagaaggcgatctc
ggcgaccagtacaacgcattcctcgactgcgaagaagtctcgcccgaagacatgaagaat
ggtgatgtgttcctgagccgcgaaggcaagctgctgcgtcccaaacgtctaccgtcgaac
ctgttccagttccgtgaagggacgggcgaagatcgctgcgtcctcgacggcatcaccagc
ctgcaggccggcgccgacctgctgtggatcgaaaccgagaagccgcatatcggccagatc
ggcggtatggtgaagcgcatccgcgaagtgattccgaatgccaagctcgtctataacaat
tcgccgagctttaactggacgctcaacttccgccagcaggttttcgatgcctggaaggaa
gaaggccgcgatctcaccaattacgaccgcgcccgtctcatggacgcagagtacgacgag
accgagctcgccgctgaagccgatgcgcgcatccagaccttccaggccgatgcggcgcgc
gaggcgggcatcttccaccacctgatcaccctgccgacctatcacacggcagcgctgagc
acggataacctcgccaagcgctacttcggtgacgaaggcatgctgggctacgtcaagaac
gttcagcgcgaggagatccgccagggcatcgcctgcgtgaagcaccagaacatggccggt
tcggacatcggtgacgatcacaaggagtattttgccggtgaagctgccctgaaggcgggc
ggcgcagataacaccatgaaccagttcgaagccgcctga

DBGET integrated database retrieval system