KEGG   Erythrobacter litoralis HTCC2594: ELI_06025Help
Entry
ELI_06025         CDS       T00315                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00071  Fatty acid degradation
eli00280  Valine, leucine and isoleucine degradation
eli00310  Lysine degradation
eli00360  Phenylalanine metabolism
eli00362  Benzoate degradation
eli00380  Tryptophan metabolism
eli00410  beta-Alanine metabolism
eli00627  Aminobenzoate degradation
eli00640  Propanoate metabolism
eli00650  Butanoate metabolism
eli00903  Limonene and pinene degradation
eli00930  Caprolactam degradation
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ELI_06025
   00650 Butanoate metabolism
    ELI_06025
  Lipid metabolism
   00071 Fatty acid degradation
    ELI_06025
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ELI_06025
   00310 Lysine degradation
    ELI_06025
   00360 Phenylalanine metabolism
    ELI_06025
   00380 Tryptophan metabolism
    ELI_06025
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ELI_06025
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ELI_06025
   00281 Geraniol degradation
    ELI_06025
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ELI_06025
   00627 Aminobenzoate degradation
    ELI_06025
   00930 Caprolactam degradation
    ELI_06025
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ELI_06025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease
Motif
Other DBs
NCBI-ProteinID: ABC63297
UniProt: Q2NAJ4
Position
complement(1245949..1246614)
Genome map
AA seq 221 aa AA seqDB search
MIETTELGAAIHARMDDGKVNDISMPMLDRLQEVLGKAAAKQQPVVLEGKPGLFSAGFDL
KTFAKGADAALKLLQAGQDAILAILRHPAPVVTICTGNAFPAGAFLMMASDRAIGIRGDF
KIGMNETMIGLVLPAYSIALATRRLAPSGRKAIGTGMMFDPEEALRVGYLDKLVDPGDLD
AERAALPAFFEGMKLPAFAGNKAQVNAEVIAAIEATELPKL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacaaccgaacttggcgcggcaattcatgcacggatggacgatggaaaggtc
aacgacatctccatgccaatgctcgaccggctgcaggaggtgctcggtaaggcagcggca
aagcaacagccagtcgttcttgaaggcaaaccggggctcttctcggccggcttcgatctc
aagactttcgcaaagggtgcagacgcggcattgaagcttctgcaggcgggacaggatgct
atccttgccatcttgcggcatcccgcaccggtcgtgacgatctgcaccggcaatgccttc
ccggcgggcgcgttcctaatgatggcatccgaccgcgcgataggcatccgcggcgacttt
aaaatcggcatgaacgaaacgatgatcgggcttgttttgcctgcttacagcatcgcgctc
gccacgcgccggctcgcgccttcgggtcgcaaggcgatcggcacgggcatgatgttcgat
cccgaagaagccctgcgcgtcggctatctcgacaaactggtcgatcccggcgatctcgac
gccgaacgcgctgcgcttccggcctttttcgaaggcatgaagctgcccgccttcgccggt
aacaaggcgcaggtgaatgcggaggtcatcgcggccatcgaggcaacggagctacctaag
ctctaa

DBGET integrated database retrieval system