KEGG   Erythrobacter litoralis: ELI_06470Help
Entry
ELI_06470         CDS       T00315                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eli  Erythrobacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_06470
   01230 Biosynthesis of amino acids
    ELI_06470
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_06470
   00051 Fructose and mannose metabolism
    ELI_06470
   00562 Inositol phosphate metabolism
    ELI_06470
Enzymes [BR:eli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ELI_06470
Exosome [BR:eli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ELI_06470
  Exosomal proteins of bladder cancer cells
   ELI_06470
  Exosomal proteins of melanoma cells
   ELI_06470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1342716..1343480)
Genome map
AA seq 254 aa AA seqDB search
MSLRPYIVGNWKMNGTRAMLSEARAIDRAAQRYMKVEVAVAPPFTLIHAVHREAEQIAVG
AQDCHADPDGAHTGDISATMAADAGAKFVILGHSERRQDHGESNELVRSKAEAALEAGLK
VILCCGEPEEKRDEGKAEEFVLTQLKLSLPDAMEDVVERLTIAYEPIWAIGTGRTPTLDD
IAAMHGAIRAFLVERFGEEDGGQIRILYGGSVKPENAREILGVANVGGALVGGASLTADS
FMNIALAAGDAEEQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccgaccctatatcgtcggcaattggaaaatgaacggaacccgcgcgatgctc
tctgaagctcgtgcgatcgaccgtgcggcgcagcgctacatgaaggtcgaggtcgccgtg
gcgccgccgttcacgctcatccacgccgtccatcgcgaagccgagcagatcgctgtcggt
gcacaggattgccatgccgatcccgacggcgcgcatacaggcgacatttccgcgaccatg
gccgccgatgccggcgcgaaattcgtgatcctgggccatagcgaacgccgccaggaccac
ggcgaatccaacgaactggtccggagcaaggccgaggcggcgctggaagccgggctcaag
gtcatcctgtgctgcggcgaacccgaggaaaagcgcgacgagggcaaggccgaggagttc
gtcctcacccagctcaagctgtcgctgccggatgcgatggaagatgtcgtcgagcgtttg
accattgcctacgaaccgatctgggcgatcggcaccgggcgtacgccgacgctggacgat
attgctgccatgcacggggcgatccgcgcgtttctcgtcgagcgattcggcgaagaagac
ggcggacagattcgcatcctctatggcggttcggtaaagcctgaaaacgcgcgcgaaatc
ctcggcgtggccaatgtcggcggcgcgctggtgggcggggcgagcctgacggcggacagc
ttcatgaatatcgcgctcgcggccggagacgccgaagagcagtag

DBGET integrated database retrieval system