KEGG   Erythrobacter litoralis: ELI_06515Help
Entry
ELI_06515         CDS       T00315                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eli  Erythrobacter litoralis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_06515 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_06515 (trpC)
Enzymes [BR:eli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ELI_06515 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1351251..1352036
Genome map
AA seq 261 aa AA seqDB search
MNKLEEICAAKLDEVATRKAALSDSELADRIAAQSAPRGFEAALRAKAVTDFALIAEIKK
ASPSKGLIRADFHPADHARAYEAGGAACLSVLTDEDYFQGHADYLREARDACTLPALRKD
FMVDPWQCAEARSMGADAILIIVAALSNAQMHEIEAAALEHRMDALVEVHDEEEMSRAHA
LQSRLVGVNNRDLKTFTTDLATTERLAPLAPAGALLVGESGIDNHADCVRLSQAGVQTFL
VGESLMRQDDVEAATRELLGG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacttgaagagatatgcgccgccaagctcgacgaagtcgcgacgcgcaaggct
gcgctgtcggatagcgaattggccgatcgcatcgcagcccaatccgcgccgcgcgggttc
gaagccgctctgcgtgccaaggccgtaaccgacttcgcactgattgccgagatcaagaaa
gcctcaccgtcgaagggtctcatccgcgcagactttcatcccgcagaccacgcccgcgcc
tatgaggcaggcggcgcggcgtgcctgtccgtcctgaccgatgaagactatttccagggc
cacgccgattacctgcgcgaagcgcgcgatgcgtgcaccctccccgccctgcgcaaggac
ttcatggtcgatccgtggcaatgcgccgaagcccggagcatgggtgccgacgcgatcctg
attatcgttgcggcactctccaatgcgcagatgcacgagatcgaagctgctgcgctggag
catcggatggatgcgctggtcgaagtgcacgacgaagaagaaatgagtcgcgcccatgcg
ctgcaatcgcggctggttggcgtcaataatcgcgacttgaaaaccttcaccaccgatctc
gcgaccaccgagcgcttggctccgctggcacccgcaggcgcgcttctggtcggagaaagc
ggtatcgacaaccacgccgattgcgtgcggctgtcgcaagcgggggtccagaccttcctc
gttggtgagagcctgatgcggcaggacgacgtcgaagccgccacccgcgaacttctcggc
ggttag

DBGET integrated database retrieval system