KEGG   Erythrobacter litoralis: ELI_06920Help
Entry
ELI_06920         CDS       T00315                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eli  Erythrobacter litoralis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:eli00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1435165..1435986)
Genome map
AA seq 273 aa AA seqDB search
MITETAYAKINLALHVRSKREDGYHEIETLFAFVDAGDVLVARAAEADRLETVGEFADVL
DNPFDNLVARTMSTLPREGGLHVTLEKNLPVAAGLGGGSADAGAMFRIIEQMHGLPDDWE
EKAIRLGADVPACVASEMAIGRGTGTDLEPVENDMAGMAVLLVNLRVPLPTGPVFKAWAD
TAGGEDLGPLPTGTAREIARKGRNDLRPPAVAICPPIADVLQALEATDPWMCEMSGSGAT
CFALYDETEMRDKAARAIAEHHPGWWQMTGTLQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgattaccgaaaccgcctacgcaaagatcaaccttgcgctgcacgtccgcagcaagcgc
gaggatggctaccacgagatcgaaacgctgttcgccttcgtcgatgcgggcgatgtgctg
gtggcgcgggcggcggaggcggatcggctggagacggtcggcgaatttgccgatgtgctc
gacaatcccttcgataatctcgtcgcgcgcacgatgtcgacgcttccccgtgagggcggg
ctgcatgtcacgctggagaagaacctgcccgtcgcagcggggctcggcggcggatcggcc
gatgcaggggcgatgttccgcatcatcgagcagatgcatgggctgcctgatgactgggaa
gagaaggccatccgccttggcgccgatgtgccagcctgcgtcgccagcgagatggcgatc
gggcgcgggaccgggaccgacctcgaaccggtcgagaacgacatggcgggtatggcggtg
ctgctggtcaacctgcgtgtgccgctgccgaccgggccggtcttcaaggcgtgggccgac
accgcaggcggtgaggatcttgggccactgcccacaggcaccgcgcgcgaaatcgcccgc
aaggggcggaacgacctgagacctcccgcggtcgccatctgccctcccatcgcggacgtc
cttcaggcgctggaggcaaccgatccgtggatgtgcgaaatgtctggatccggggcgacc
tgttttgcgttgtatgatgaaaccgaaatgcgcgataaggccgcgcgagccatcgccgaa
catcacccgggctggtggcagatgacaggaactctccaatga

DBGET integrated database retrieval system