KEGG   Erythrobacter litoralis: ELI_07590Help
Entry
ELI_07590         CDS       T00315                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eli  Erythrobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_07590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_07590
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_07590
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ELI_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
1570553..1571767
Genome map
AA seq 404 aa AA seqDB search
MATKANSFRTQPDERGHFGQFGGRYVAETLMPLVLDLEREYRAAQADPAFQAQFDDLLEH
YVGRPSPLYFAERLTEALGGAQVWFKRDELNHTGAHKINNCIGQILLAERMGKTRIIAET
GAGQHGVATATVCARFGLPCVIYMGAEDVKRQSPNVFRMKLLGAEVVPVTSGGATLKDAM
NEGLRDWVANVHDTFYIIGTAAGPHPYPELVRDFQSVIGKEARAQMLDRTGRLPDLLIAC
IGGGSNALGLFHPFLDDPDVKMLGVEAAGHGLDGDQHAASLLGGAPGILHGNKTYLLQDE
DGQITEGHSISAGLDYPGIGPEHAWLKESGRVEYTAVTDDEALDGFQLLCRTEGIIPALE
PSHAIAAVADRAKQMSEDQIILMNLCGRGDKDIFTVAEKLGVEM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccaaggcgaattccttccgcacccagcctgacgagcgcgggcatttcggccag
ttcggtgggcgctatgtcgctgaaacgctgatgccgctcgtgctggacctagagcgcgaa
tatcgcgcggcgcaggccgatcctgcctttcaggcccaattcgacgacctgctcgaacac
tacgtcggccgcccctccccgctctatttcgcagaacgcctcaccgaggcgctcggcggc
gcgcaggtctggttcaaacgcgacgagctcaaccacactggcgcgcataagatcaacaat
tgcatcgggcagatcctgctcgccgagcgcatgggtaagacccgcatcatcgcggagacc
ggcgcggggcaacacggcgtcgccaccgccaccgtctgcgcgcggttcggcctgccttgc
gtcatctacatgggcgcggaggacgtaaagcggcagtcgcccaatgtcttccgcatgaag
ctgctcggcgcagaagtcgtccccgtcaccagcggcggcgcgacgctcaaggacgcgatg
aacgaagggctgcgcgactgggtcgcgaatgtccacgacaccttctacatcatcggcacc
gccgccgggccgcatccctatccggagctggtgcgcgatttccagagcgtgatcggcaag
gaagcccgcgcgcaaatgctcgaccgcacgggccgcctgcccgatttgctgatcgcctgc
atcggcggcggctccaacgcgctcggcctgttccacccgtttcttgacgatccggacgtg
aagatgctcggcgtcgaagcggcgggccatggtcttgacggcgaccagcatgccgccagc
ctgctcggcggcgcgcccggcatattgcacggcaacaagacctacctgctgcaggacgag
gacggccagatcaccgaaggccactcgatcagcgccggcctcgactaccccggcatcggc
cccgaacacgcatggctgaaagagtcaggccgcgtcgaatacaccgccgtgaccgatgac
gaggccttggacggcttccagctgctttgccgcaccgaggggattattcccgctctggaa
ccgtcacacgccatcgcggcggtcgccgaccgcgccaaacagatgagcgaggaccagatc
atcctgatgaacctgtgcggacgcggggataaggacatcttcacggtggcggagaagctg
ggagtggagatgtaa

DBGET integrated database retrieval system