KEGG   Erythrobacter litoralis: ELI_07590Help
Entry
ELI_07590         CDS       T00315                                 

Definition
(GenBank) probable tryptophan synthase beta chain protein
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eli  Erythrobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_07590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_07590
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_07590
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ELI_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1570466..1571767
Genome map
AA seq 433 aa AA seqDB search
MLVEGPYFFFTLRQKQERGFDRLSPNGFFVATKANSFRTQPDERGHFGQFGGRYVAETLM
PLVLDLEREYRAAQADPAFQAQFDDLLEHYVGRPSPLYFAERLTEALGGAQVWFKRDELN
HTGAHKINNCIGQILLAERMGKTRIIAETGAGQHGVATATVCARFGLPCVIYMGAEDVKR
QSPNVFRMKLLGAEVVPVTSGGATLKDAMNEGLRDWVANVHDTFYIIGTAAGPHPYPELV
RDFQSVIGKEARAQMLDRTGRLPDLLIACIGGGSNALGLFHPFLDDPDVKMLGVEAAGHG
LDGDQHAASLLGGAPGILHGNKTYLLQDEDGQITEGHSISAGLDYPGIGPEHAWLKESGR
VEYTAVTDDEALDGFQLLCRTEGIIPALEPSHAIAAVADRAKQMSEDQIILMNLCGRGDK
DIFTVAEKLGVEM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgtcgaagggccgtacttcttttttacgctgcgccagaagcaagaacggggcttc
gacaggctcagcccgaacggattttttgtggcaaccaaggcgaattccttccgcacccag
cctgacgagcgcgggcatttcggccagttcggtgggcgctatgtcgctgaaacgctgatg
ccgctcgtgctggacctagagcgcgaatatcgcgcggcgcaggccgatcctgcctttcag
gcccaattcgacgacctgctcgaacactacgtcggccgcccctccccgctctatttcgca
gaacgcctcaccgaggcgctcggcggcgcgcaggtctggttcaaacgcgacgagctcaac
cacactggcgcgcataagatcaacaattgcatcgggcagatcctgctcgccgagcgcatg
ggtaagacccgcatcatcgcggagaccggcgcggggcaacacggcgtcgccaccgccacc
gtctgcgcgcggttcggcctgccttgcgtcatctacatgggcgcggaggacgtaaagcgg
cagtcgcccaatgtcttccgcatgaagctgctcggcgcagaagtcgtccccgtcaccagc
ggcggcgcgacgctcaaggacgcgatgaacgaagggctgcgcgactgggtcgcgaatgtc
cacgacaccttctacatcatcggcaccgccgccgggccgcatccctatccggagctggtg
cgcgatttccagagcgtgatcggcaaggaagcccgcgcgcaaatgctcgaccgcacgggc
cgcctgcccgatttgctgatcgcctgcatcggcggcggctccaacgcgctcggcctgttc
cacccgtttcttgacgatccggacgtgaagatgctcggcgtcgaagcggcgggccatggt
cttgacggcgaccagcatgccgccagcctgctcggcggcgcgcccggcatattgcacggc
aacaagacctacctgctgcaggacgaggacggccagatcaccgaaggccactcgatcagc
gccggcctcgactaccccggcatcggccccgaacacgcatggctgaaagagtcaggccgc
gtcgaatacaccgccgtgaccgatgacgaggccttggacggcttccagctgctttgccgc
accgaggggattattcccgctctggaaccgtcacacgccatcgcggcggtcgccgaccgc
gccaaacagatgagcgaggaccagatcatcctgatgaacctgtgcggacgcggggataag
gacatcttcacggtggcggagaagctgggagtggagatgtaa

DBGET integrated database retrieval system