KEGG   Erythrobacter litoralis: ELI_07595Help
Entry
ELI_07595         CDS       T00315                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eli  Erythrobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_07595
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_07595
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_07595
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ELI_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1572093..1572872
Genome map
AA seq 259 aa AA seqDB search
MTRLQNAFSKPHAAFVAFITAGDGDTAANLDALVAGGADVIELGMPFTDPMADGPAIQAA
NIRSLARGTTTRDVLMIANEFRERHPEVPLVLMGYANPMVRRGPEWFAAECKGCGVDGVI
CVDIPPEEDAELGPALRAAGIAPIRLATPTTDAKRLPAVLEGCEGFVYYVSVAGITGKQQ
AALDTIESNVARIKRSTDLPVAVGFGVRTPEQAGAIARVADGVVVGSALVELVGEFGTEA
PAKLQELTKALADAVHSAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctccaaaacgccttctccaaaccccacgccgccttcgttgccttcatcacc
gctggtgacggggacacggcggcgaaccttgatgcgctggttgcgggcggtgcggatgtg
atcgagttgggcatgcccttcaccgatcccatggccgatggccccgcgatccaggcggcc
aatatccgctcgcttgcgcgcggcacgaccacgcgcgatgtgctgatgatcgccaacgag
ttccgcgagcgccacccggaggtgccgctggtattgatgggctacgccaacccgatggtg
cggcgcgggccggaatggttcgccgccgagtgcaagggctgcggcgtcgatggggtgatt
tgcgtcgatatcccgcccgaggaagacgccgagctcggccccgccctgcgcgcagcgggc
atcgccccgatccggctcgccacgcccaccaccgatgccaagcgcctgccagcagtgctc
gagggatgcgaaggcttcgtctattacgtttctgtcgccgggatcaccggcaagcaacag
gccgcgctcgacacgatcgaaagcaatgtggcgcggatcaagcgatcgaccgacctgccc
gtcgcggtcggcttcggcgtgcgcacgcccgaacaggcgggcgctatcgccagggtcgcg
gacggcgtggtcgtcggctccgcgctggtcgaactggtcggcgaatttggcaccgaggcc
ccggccaagctacaagagctgaccaaggcactggctgacgcggtccattccgcacgctaa

DBGET integrated database retrieval system