KEGG   Erythrobacter litoralis: ELI_07595Help
Entry
ELI_07595         CDS       T00315                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eli  Erythrobacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eli01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:eli00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:eli00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1572093..1572872
Genome map
AA seq 259 aa AA seqDB search
MTRLQNAFSKPHAAFVAFITAGDGDTAANLDALVAGGADVIELGMPFTDPMADGPAIQAA
NIRSLARGTTTRDVLMIANEFRERHPEVPLVLMGYANPMVRRGPEWFAAECKGCGVDGVI
CVDIPPEEDAELGPALRAAGIAPIRLATPTTDAKRLPAVLEGCEGFVYYVSVAGITGKQQ
AALDTIESNVARIKRSTDLPVAVGFGVRTPEQAGAIARVADGVVVGSALVELVGEFGTEA
PAKLQELTKALADAVHSAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctccaaaacgccttctccaaaccccacgccgccttcgttgccttcatcacc
gctggtgacggggacacggcggcgaaccttgatgcgctggttgcgggcggtgcggatgtg
atcgagttgggcatgcccttcaccgatcccatggccgatggccccgcgatccaggcggcc
aatatccgctcgcttgcgcgcggcacgaccacgcgcgatgtgctgatgatcgccaacgag
ttccgcgagcgccacccggaggtgccgctggtattgatgggctacgccaacccgatggtg
cggcgcgggccggaatggttcgccgccgagtgcaagggctgcggcgtcgatggggtgatt
tgcgtcgatatcccgcccgaggaagacgccgagctcggccccgccctgcgcgcagcgggc
atcgccccgatccggctcgccacgcccaccaccgatgccaagcgcctgccagcagtgctc
gagggatgcgaaggcttcgtctattacgtttctgtcgccgggatcaccggcaagcaacag
gccgcgctcgacacgatcgaaagcaatgtggcgcggatcaagcgatcgaccgacctgccc
gtcgcggtcggcttcggcgtgcgcacgcccgaacaggcgggcgctatcgccagggtcgcg
gacggcgtggtcgtcggctccgcgctggtcgaactggtcggcgaatttggcaccgaggcc
ccggccaagctacaagagctgaccaaggcactggctgacgcggtccattccgcacgctaa

DBGET integrated database retrieval system