KEGG   Erythrobacter litoralis HTCC2594: ELI_08005Help
Entry
ELI_08005         CDS       T00315                                 

Definition
(GenBank) dihydrolipoamide succinyl transferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00020  Citrate cycle (TCA cycle)
eli00310  Lysine degradation
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
Module
eli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ELI_08005
  Amino acid metabolism
   00310 Lysine degradation
    ELI_08005
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ELI_08005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABC63693
UniProt: Q2N9E8
Position
1659659..1660909
Genome map
AA seq 416 aa AA seqDB search
MTTEIQVPQLGESVTEGTIGEWLKQPGDAVEVDEPIASLETDKVAVEVPSPVAGVIGELK
AEVGDTVEVGAVIATVEEGATGAATKGEEPARSQEKREQGREERAEQEEATDSPSVDGSQ
TLSPAVRRAVLEHGVDPSTIKGTGKDGRLTKEDVVAAARAKRDGGGESASAPAPAPAAAT
SGGERREERVKMTRMRQTIAKRLKGAQEEAALLTTFNDVDMSAVIEARTKYKDLFAKKHD
IRLGFMGFFAKAACLALKDVPSVNAYIEGEEIVYHDYIDISVAVSAPNGLVVPVIRDAQA
KGFAQIEKDIADFGKRAKEGTLTMEDMKGGTFTISNGGVFGSLMSTPIINPPQSAVLGLH
RIEDRPVAVNGEVVIRPMMYIALSYDHRLIDGREAVTALKIIKEAIEDPTRMLIDL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaaatccaggtcccccagctcggtgaatcggtcaccgaaggcacgatcggc
gaatggctcaagcagcccggcgatgcggtcgaggtcgacgagcccatcgccagcctcgag
accgacaaggtcgcggtcgaggtgccttccccggtcgcgggcgtgatcggcgagctcaag
gccgaggttggcgacaccgtcgaagtcggcgccgtgatcgcaacggtcgaagaaggcgcg
accggcgctgcgaccaagggtgaagagcccgcccgctcgcaggaaaaacgcgagcaaggc
cgggaagaacgcgccgagcaggaagaagcgaccgattccccctctgtcgacggatcgcag
acgctcagcccggccgtgcgccgcgcagtgctggaacacggggtcgatccctcgaccatc
aagggcaccggcaaggacgggcgcctgaccaaggaagacgtggtcgccgcggcgcgcgcc
aagcgcgatggcggcggcgagagcgccagcgctcccgccccagccccggccgcagccact
tccggcggcgaacgccgcgaggagcgcgtcaagatgacgcgcatgcgccagaccatcgcc
aagcgtttgaagggcgcgcaggaagaggccgcgctgctcacgaccttcaatgatgtcgac
atgtccgcggtgatcgaggcacgcacgaagtacaaggatttgttcgccaagaagcacgac
atccgcttgggcttcatgggcttcttcgccaaagccgcgtgccttgccctgaaggacgtg
ccgagcgtcaacgcctatatcgaaggcgaagagatcgtctatcacgactacatcgatatt
tccgtcgccgtcagcgcgcccaatggcctggtggttccggtgatccgcgacgcgcaggcc
aagggtttcgctcagatcgagaaagacatcgccgatttcggcaagcgcgcaaaggaaggc
acgctgacgatggaagacatgaagggcggcaccttcaccatctccaacggcggcgtgttc
ggcagcctgatgtcgaccccgatcatcaacccgccgcaaagcgcggtgctgggcctgcat
cgcattgaagaccgtccggttgccgtgaatggcgaagtcgtcatccgcccgatgatgtac
atcgcgctgagttacgaccaccgcctgatcgacggccgcgaagccgtcaccgcactcaag
atcatcaaggaagcgatcgaagatcccacccggatgctgatcgacctctag

DBGET integrated database retrieval system