KEGG   Erythrobacter litoralis: ELI_08910Help
Entry
ELI_08910         CDS       T00315                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eli  Erythrobacter litoralis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_08910
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_08910
   00630 Glyoxylate and dicarboxylate metabolism
    ELI_08910
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ELI_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1814131..1816245)
Genome map
AA seq 704 aa AA seqDB search
MTDYTTKARLQIDPALAAFLEGEVLAPLGRDADAFWQGFSNLVHGFTPRNRDLLAKREEL
QAKIDAWHRKRRGQSHDHAAYKAFLSEIGYLVPEPDAFTIGTQNVDPEIATMAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDALDAPPAKPGGYDEERGAAVIAEARRFLDEAVPL
KSGSWADLTLERIEADGIAIADESQYVGETEKGRLFKNNGLHIEVQWAPESSVGKSDQAG
ISDVVIESALTTIADCEDSVAAVDAEDKLLAYTNWLGIIRGDLQESFEKRGRTMTRALNG
DKSYTDTHGEAQTLPGRSLMFVRNVGHLMTNPAILLEDGSEIPEGIMDAVVTSAISAHDV
QGLGRYGNSRTGSIYIVKPKMHGPEECAFTNDLFDAVEDLLELPRHTIKVGVMDEERRTS
ANLAACILAVRDRIVFINTGFLDRTGDEIHTSMQAGPMMRKGEMKGSAWLDAYEKRNVGI
GMACGLSGRAQIGKGMWPAPDLMGKMMLEKIGHLRAGANTAWVPSPTAATLHALHYHRED
VFAIQRDLGEAPGLDRLLTIPLAEATNWPEDEVREELDNNAQGLLGYVVRWIDAGVGCSK
VPDISDVGLMEDRATLRISSQHMANWLLHGVASENQVMDSLKRMAAKVDEQNAGDLSYEP
MAGNWETSLAFKAACDLVFKGVEQPSGYTEPLLHQWRLRKKAGA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacacgaccaaagcccgcctgcagatcgatcctgcgctcgccgcgttcctg
gaaggcgaggtgctggcacccctgggcagggacgcagacgcattctggcagggcttctcc
aacctggtccacggcttcactccgcgcaatcgcgacctgcttgccaagcgtgaagagctg
caggccaaaatcgacgcctggcatcgcaagcgccgcggacaaagccacgatcatgcagcc
tacaaagcgttcctgagcgagatcggctacctcgtcccggagccggatgcgttcactatc
ggcacgcagaacgtcgatcccgaaatcgcgaccatggccgggccgcagctggtggtgccg
atcctcaatgcgcggttcctgctgaatgccgccaacgcccgctggggcagcctctatgac
gcgctctacggaaccgatgcgctcgacgcgccgcctgcaaaacccggtggctatgacgag
gaacgcggcgcggcggtgatcgccgaggcccgcaggttccttgatgaggcggtgccgctg
aagtccggcagttgggccgaccttacgctggagcgtatcgaggccgatggcattgcgatt
gccgacgagagccagtatgtcggcgagaccgagaagggccgtttgttcaaaaacaacggc
ctgcacatcgaagttcaatgggcccccgagagttcggtcgggaagtccgaccaggccggc
atcagcgatgtcgtgatcgaaagtgcgctgacgacgatcgccgattgcgaggattcggtg
gcggcggtcgatgccgaagacaagctgctcgcctacaccaactggctcggcatcattcgc
ggcgatctgcaggagagcttcgagaaacgcgggcgcacgatgacccgcgcgctgaatggc
gacaagagctacaccgatacccatggcgaggcgcagacgctgccaggccggagcctgatg
tttgtccgcaatgtcgggcacttgatgaccaatcctgcgatcctgctggaggatggcagc
gagatccccgaaggcatcatggacgccgtcgtcacaagcgcgatcagcgcgcatgatgtg
cagggacttggccgatacggcaattcgcgcaccggcagcatctatatcgtcaagccgaag
atgcacggcccggaagaatgtgcgtttaccaatgacttgttcgacgcggttgaggatttg
ctcgaactgccgcgccacacgattaaggttggggtgatggacgaggagcgccgcacttcg
gcgaatctcgctgcgtgcattctcgcggtgcgcgaccggatcgtcttcatcaacaccggt
ttcctcgaccggacgggcgacgaaatccatacctcgatgcaggccgggccgatgatgcgc
aagggcgagatgaaaggcagcgcctggctcgatgcctacgagaagcgcaatgtcggcatc
ggcatggcttgcggcctgtcggggcgcgcgcagatcggcaagggcatgtggcccgcgccg
gatctgatgggcaagatgatgctggagaagatcggccatttgcgcgcgggggccaatacg
gcctgggtaccgtcgccgaccgcggcgacgctccacgcgctgcattatcaccgcgaggac
gtgtttgcgatccagcgggacctcggcgaagcgcccggcctcgatcggctgctcaccatc
ccgctcgccgaggcgacgaactggccggaagacgaagtgcgcgaggaactcgataacaat
gcgcaaggcctgctcggctatgtcgtgcgctggatcgatgcgggcgtcggctgttccaag
gtgccggacatcagcgatgtcggcctgatggaagaccgtgccaccttgcgcatctccagc
cagcacatggccaactggctcctccacggcgtggcgagcgagaaccaagtgatggacagc
ctcaagcgcatggccgccaaggtcgacgagcagaatgcaggcgacctgtcctacgagccg
atggcaggcaattgggaaacgagcctcgcgttcaaggccgcctgcgatctcgtgttcaaa
ggcgtggagcagccgagcggctataccgagccgctgctgcatcaatggcggctgcgcaag
aaagcgggagcctga

DBGET integrated database retrieval system