KEGG   Erythrobacter litoralis HTCC2594: ELI_08910Help
Entry
ELI_08910         CDS       T00315                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00620  Pyruvate metabolism
eli00630  Glyoxylate and dicarboxylate metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01200  Carbon metabolism
Module
eli_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_08910
   00630 Glyoxylate and dicarboxylate metabolism
    ELI_08910
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ELI_08910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABC63874
UniProt: Q2N8W7
Position
complement(1814131..1816245)
Genome map
AA seq 704 aa AA seqDB search
MTDYTTKARLQIDPALAAFLEGEVLAPLGRDADAFWQGFSNLVHGFTPRNRDLLAKREEL
QAKIDAWHRKRRGQSHDHAAYKAFLSEIGYLVPEPDAFTIGTQNVDPEIATMAGPQLVVP
ILNARFLLNAANARWGSLYDALYGTDALDAPPAKPGGYDEERGAAVIAEARRFLDEAVPL
KSGSWADLTLERIEADGIAIADESQYVGETEKGRLFKNNGLHIEVQWAPESSVGKSDQAG
ISDVVIESALTTIADCEDSVAAVDAEDKLLAYTNWLGIIRGDLQESFEKRGRTMTRALNG
DKSYTDTHGEAQTLPGRSLMFVRNVGHLMTNPAILLEDGSEIPEGIMDAVVTSAISAHDV
QGLGRYGNSRTGSIYIVKPKMHGPEECAFTNDLFDAVEDLLELPRHTIKVGVMDEERRTS
ANLAACILAVRDRIVFINTGFLDRTGDEIHTSMQAGPMMRKGEMKGSAWLDAYEKRNVGI
GMACGLSGRAQIGKGMWPAPDLMGKMMLEKIGHLRAGANTAWVPSPTAATLHALHYHRED
VFAIQRDLGEAPGLDRLLTIPLAEATNWPEDEVREELDNNAQGLLGYVVRWIDAGVGCSK
VPDISDVGLMEDRATLRISSQHMANWLLHGVASENQVMDSLKRMAAKVDEQNAGDLSYEP
MAGNWETSLAFKAACDLVFKGVEQPSGYTEPLLHQWRLRKKAGA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacacgaccaaagcccgcctgcagatcgatcctgcgctcgccgcgttcctg
gaaggcgaggtgctggcacccctgggcagggacgcagacgcattctggcagggcttctcc
aacctggtccacggcttcactccgcgcaatcgcgacctgcttgccaagcgtgaagagctg
caggccaaaatcgacgcctggcatcgcaagcgccgcggacaaagccacgatcatgcagcc
tacaaagcgttcctgagcgagatcggctacctcgtcccggagccggatgcgttcactatc
ggcacgcagaacgtcgatcccgaaatcgcgaccatggccgggccgcagctggtggtgccg
atcctcaatgcgcggttcctgctgaatgccgccaacgcccgctggggcagcctctatgac
gcgctctacggaaccgatgcgctcgacgcgccgcctgcaaaacccggtggctatgacgag
gaacgcggcgcggcggtgatcgccgaggcccgcaggttccttgatgaggcggtgccgctg
aagtccggcagttgggccgaccttacgctggagcgtatcgaggccgatggcattgcgatt
gccgacgagagccagtatgtcggcgagaccgagaagggccgtttgttcaaaaacaacggc
ctgcacatcgaagttcaatgggcccccgagagttcggtcgggaagtccgaccaggccggc
atcagcgatgtcgtgatcgaaagtgcgctgacgacgatcgccgattgcgaggattcggtg
gcggcggtcgatgccgaagacaagctgctcgcctacaccaactggctcggcatcattcgc
ggcgatctgcaggagagcttcgagaaacgcgggcgcacgatgacccgcgcgctgaatggc
gacaagagctacaccgatacccatggcgaggcgcagacgctgccaggccggagcctgatg
tttgtccgcaatgtcgggcacttgatgaccaatcctgcgatcctgctggaggatggcagc
gagatccccgaaggcatcatggacgccgtcgtcacaagcgcgatcagcgcgcatgatgtg
cagggacttggccgatacggcaattcgcgcaccggcagcatctatatcgtcaagccgaag
atgcacggcccggaagaatgtgcgtttaccaatgacttgttcgacgcggttgaggatttg
ctcgaactgccgcgccacacgattaaggttggggtgatggacgaggagcgccgcacttcg
gcgaatctcgctgcgtgcattctcgcggtgcgcgaccggatcgtcttcatcaacaccggt
ttcctcgaccggacgggcgacgaaatccatacctcgatgcaggccgggccgatgatgcgc
aagggcgagatgaaaggcagcgcctggctcgatgcctacgagaagcgcaatgtcggcatc
ggcatggcttgcggcctgtcggggcgcgcgcagatcggcaagggcatgtggcccgcgccg
gatctgatgggcaagatgatgctggagaagatcggccatttgcgcgcgggggccaatacg
gcctgggtaccgtcgccgaccgcggcgacgctccacgcgctgcattatcaccgcgaggac
gtgtttgcgatccagcgggacctcggcgaagcgcccggcctcgatcggctgctcaccatc
ccgctcgccgaggcgacgaactggccggaagacgaagtgcgcgaggaactcgataacaat
gcgcaaggcctgctcggctatgtcgtgcgctggatcgatgcgggcgtcggctgttccaag
gtgccggacatcagcgatgtcggcctgatggaagaccgtgccaccttgcgcatctccagc
cagcacatggccaactggctcctccacggcgtggcgagcgagaaccaagtgatggacagc
ctcaagcgcatggccgccaaggtcgacgagcagaatgcaggcgacctgtcctacgagccg
atggcaggcaattgggaaacgagcctcgcgttcaaggccgcctgcgatctcgtgttcaaa
ggcgtggagcagccgagcggctataccgagccgctgctgcatcaatggcggctgcgcaag
aaagcgggagcctga

DBGET integrated database retrieval system