KEGG   Erythrobacter litoralis: ELI_08995Help
Entry
ELI_08995         CDS       T00315                                 

Definition
acyl-CoA thioesterase i protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eli  Erythrobacter litoralis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ELI_08995
Enzymes [BR:eli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ELI_08995
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ELI_08995
Lipid biosynthesis proteins [BR:eli01004]
 Fatty acid synthase
  Component type
   ELI_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1828020..1828595)
Genome map
AA seq 191 aa AA seqDB search
MGPERRILAFGDSLFAGYNVAKSDSYPAKLESALRARGINARVTNAGVSGDTSAAGLQRF
EFTLDSLQETPDLLILELGGNDLLRGLSPDETRRNLESMIRTAQARGIDVLLMGMRSPAN
MGAQFVEEFNGLYAELAEQYGTDFIPVWVESVADRPELIQDDRVHPTEAGIELLVSETLD
DVVAAIPEATN
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccgagcggcgaatccttgccttcggggatagcctgtttgcaggatacaatgtc
gccaagagcgatagctatccggccaaactggaaagcgctctaagggcacgaggcatcaat
gcgcgggtcacgaatgccggtgtttccggcgataccagcgcggcggggctgcagcggttc
gaattcacgctcgactcgttgcaggagacacccgacctgctgatcctggagctcgggggg
aacgacctgctgcgcgggctttcgcccgatgagacgcgtagaaatcttgaaagcatgatc
cggacggcgcaggcgcgcgggatcgatgtcttgctgatgggcatgcgctcccccgccaat
atgggcgcgcaattcgtcgaggaattcaatggcctctatgccgagctcgccgagcaatat
ggcaccgacttcatcccggtctgggtggaatccgtggccgacaggcccgaactgatccag
gacgaccgggtccatccgaccgaggcgggaatcgaactgctggtgagcgaaacgctggac
gacgtggtcgcagcaatacctgaagcgacaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system