KEGG   Erythrobacter litoralis: ELI_09565Help
Entry
ELI_09565         CDS       T00315                                 

Gene name
hisH
Definition
imidazole glycerol phosphate synthase subunit HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
eli  Erythrobacter litoralis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eli01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:eli00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1950214..1950846)
Genome map
AA seq 210 aa AA seqDB search
MAERIALIDYGAGNLHSVHNALKAAGAHGVKVTHNPDLVRMADRVVLPGVGSYKACADGL
RGIAGMVDALEERVLLGGVPFLGICVGMQLLATRGLEHAETPGLDWVAGEVRLIEPTDPS
VKVPHMGWNDVALTPHAKNHALVDEGEAYFLHSYHFHADEGRDVLAMTDHGGGLVAAVAR
DNIVGVQFHPEKSQAYGLGLLTRFLDWNPA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaggatcgcgctgatcgactatggcgcgggcaacctgcattcagttcacaac
gcattgaaggctgccggagcgcacggggtcaaagttacgcataatcccgatcttgtccgc
atggcggatcgcgtggtgttgccgggtgtcggttcttacaaggcttgtgccgatggactg
cgcggcattgcgggaatggtcgatgcgctggaggagcgggtgctgctgggcggcgtacca
ttcctcggcatttgcgtgggcatgcaattgctggcgacccgcgggctggaacatgccgaa
acgccggggctcgactgggtggcgggcgaagtgcggctgatcgagccgaccgatccgagc
gtcaaggtgcctcacatgggctggaacgacgtggcattgacgccgcatgcgaaaaaccac
gcattggtcgacgagggcgaagcgtatttcctccattcctatcattttcatgccgatgag
ggccgcgacgtcctagcgatgaccgaccatggcggcgggcttgtggcggcggtggcgcgg
gataatatcgtcggcgtgcaatttcacccggagaagagccaagcctatgggctggggctg
ctcacccgttttctcgattggaacccggcatga

DBGET integrated database retrieval system