KEGG   Erythrobacter litoralis: ELI_10285Help
Entry
ELI_10285         CDS       T00315                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
eli  Erythrobacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ELI_10285
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ELI_10285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087840..2088517)
Genome map
AA seq 225 aa AA seqDB search
MDKQNTIFGWVLFSGIVGLGLAIVSGKYFHADNLEAPENPGYFVAGAAEGGGGAEEMTMA
AALNMDGVDVSAGEAVFAKCTACHTIEQGGANGIGPNLYGIMGKDIASLAGFAYSDALSA
KEGAWTWDEMNAWLKSPRGYANGTKMSFAGLSKIEDRAAVALYMNSMGSNIPVPEYVEAV
AAEAEGAEGGATDGEAGVEGGAIDPVEAAEAMDMAQPVPGNPPGT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggataagcaaaacaccatcttcggctgggtcctcttttcgggcatcgtcggtctcggc
ctagcgatcgtcagcggcaagtacttccacgcagacaacctcgaagcgccggaaaatccc
ggctacttcgtggcgggcgcggccgaaggtggcggtggcgccgaggaaatgaccatggcg
gctgctctgaacatggatggcgtcgacgtctcggccggtgaagccgtgtttgcgaagtgt
accgcgtgccacacgatcgagcagggcggcgccaacggcatcggcccgaacctctacggc
atcatgggcaaggatatcgccagcctcgctggcttcgcctattccgatgcgctttcggcc
aaggaaggcgcctggacctgggacgagatgaacgcctggctgaagagtccgcgcggttat
gccaacggcaccaagatgagctttgccggcctgtccaagatcgaggaccgcgcagcggtg
gcgctctacatgaacagcatgggctcgaatatccctgtgcccgaatacgtcgaagccgtt
gcagccgaagccgaaggcgcggaaggcggggcgaccgatggcgaagccggtgtcgaaggc
ggtgcgatcgatccggtcgaagcggccgaagccatggatatggcgcagccggtgcctgga
aatccgccgggtacctga

DBGET integrated database retrieval system