KEGG   Erythrobacter litoralis: ELI_10555Help
Entry
ELI_10555         CDS       T00315                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
eli  Erythrobacter litoralis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:eli03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2140494..2141309
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTVRGLARFLQGERITRTVTNRPDMRFPFPDGLGQALTGATVVSLGRRAKYG
LIHTDRDQTMIFHLGMSGRWRIDPDETDKHDHLLIETADHRFALCDPRRFGWVDLVGTQA
LDQWPGFAAMGPEPLGDALTIEHLRAALSGRKQAIKLCLLDQAIVAGLGNIYVCEALWHA
RIHPRKAGGRVSKQALSLLITAIRDVLEQSIRDGGSSLRDYAQPDGELGYFATRFQVYGR
DGQPCHRDDGGTIRRFAQGGRSTWYCPRCQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttacctgaagtcgaaacaacggttcgcgggctcgcgcggttcctccaaggc
gagcggatcacccgcaccgtcaccaacaggcccgacatgcgttttcccttccccgatggt
ctggggcaggcgctcaccggtgcgaccgtcgtttcgctcgggcggcgagccaaatacggg
ctgatccataccgacagagaccagacgatgatcttccatctcgggatgagcgggcggtgg
aggatcgatccggacgaaaccgacaagcacgatcacctgctgatcgaaacggcggatcat
cgcttcgcgctctgcgatccgcgccgtttcggctgggtcgacctggtcggtacacaggcg
ctcgatcaatggccgggcttcgccgcaatggggccggagccgctcggcgatgcgctgaca
atcgagcatctccgtgccgcgctctccggacgcaagcaggcgatcaagctttgcctgctc
gaccaagcgatcgtggcgggcctcggcaatatctatgtctgcgaagcgctctggcacgcg
cgcattcatcctcgcaaggccggcgggcgagtctcgaaacaggcgctttctctcttgatc
accgcgatccgcgacgtgctcgaacaatcgatccgcgacggtggctcgagcctgcgcgac
tatgcccagcccgatggcgaactcggctatttcgctacccgcttccaagtctatggccgc
gacggccagccctgccaccgcgacgacggcggcacgatccgccgcttcgctcaaggcggc
cgcagcacgtggtattgtccgcgctgccaacgttag

DBGET integrated database retrieval system