KEGG   Erythrobacter litoralis: ELI_11220Help
Entry
ELI_11220         CDS       T00315                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
eli  Erythrobacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eli00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eli02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2268314..2268766)
Genome map
AA seq 150 aa AA seqDB search
MKHFAVPVLLAFVLIGCGSAEEPPVEQIVVREPGEVATAAAQLADKASDPVAAGEAGFAA
CAACHVAKAGAASGIGPNLYGVVGREAGALPNFGYSDAMASADFVWDEARLNAYLGDPNG
VVPGTSMVAGAVSDAAKREAIIAYLATLSE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttgctgtgccggttttgttggctttcgtattgattggctgcggctctgcg
gaagagccgcctgtggaacagatcgtggtgcgtgagccgggcgaggttgccaccgcggcc
gcccaacttgctgataaggcaagcgaccctgtggccgcaggtgaagctggattcgccgct
tgcgctgcctgccatgtcgccaaggccggagcggcctcaggcatcgggcccaacctctac
ggcgttgtcggacgggaagcgggagcgctgcccaatttcggctattctgatgcgatggcg
tctgcggatttcgtgtgggacgaagcgaggcttaatgcctatctcggcgatcccaacggc
gtggtgccgggcacttcgatggttgccggcgctgtgagcgatgcggcaaagcgcgaagcg
atcatcgcctacctcgccacactgtccgagtga

DBGET integrated database retrieval system