KEGG   Erythrobacter litoralis: ELI_11250Help
Entry
ELI_11250         CDS       T00315                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eli  Erythrobacter litoralis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:eli02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:eli02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2275463..2276491)
Genome map
AA seq 342 aa AA seqDB search
MAVRVMIVDDSITARAALARAIDSSGTAKVVGTASSAEVALQLLREQRVDVILLDLEMPG
MGGLEALPRLIEASAGAQILVVSSLTTAGAEPTLAAMAMGAADTLAKPRAGDFNEAYRAE
LLAKLLALAGTADTADLPSSPAVRPATRTIRPELIALGASTGGIHALGRFFAALPQSVTV
PMVLTQHLPHSFMPVFARQVSAMAKRPAAIAADGELIRPNTVMIAPGHAHLEVRRSGGAL
TCALVKFPAPSGCCPSVDPMFESVANVVGHAGLGIVLSGMGRDGALGALQLDRAGGTVLA
QNEDSCAVFGMPRGVVEAGIARAIEPPEALARYVANLAGVDA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccgggtcatgatcgtggacgattcgatcaccgcgcgggctgcgttggcgagg
gccatcgacagcagcggcacggcaaaggtcgtgggcactgccagcagcgccgaagtcgcc
ctgcaattgctgcgcgagcagcgggtcgatgtcatcctgctcgatctcgaaatgcctggc
atgggcggtctcgaggccctgccgcgcctgatcgaggcgtctgcgggggcgcaaattctc
gtcgtctccagtctcaccactgccggagccgagccgacactggccgccatggcgatgggc
gctgccgataccctggcgaaaccccgggccggagacttcaacgaagcctaccgggccgag
ctgctcgccaagctgctagcgctcgctggaactgccgataccgccgatttgccatctagc
ccggcggtccggcccgccacccgcaccatcaggccggaattgatcgcgctaggtgcatcg
accggcggaatccacgcgctcgggcgcttcttcgccgcgcttccacagtctgtcactgtg
ccgatggtgttgacgcaacatctgcctcacagcttcatgccggtattcgcacggcaggtg
agcgccatggccaaacggcccgccgcaatcgccgccgacggcgaacttatccggccgaat
accgtcatgatcgctccgggacatgcccatctggaagtgcgcagaagcggcggtgcgctg
acctgtgccctcgtcaaattccccgcccccagcggatgctgcccttccgtcgatcccatg
ttcgaatccgtcgctaatgtcgttggccacgccgggctcggcatcgtcctgtccggtatg
ggccgcgacggtgctttgggcgcgctgcaactcgatcgggcgggagggaccgtgctcgcc
cagaacgaggacagttgcgcggtgttcggtatgccgcgcggcgtcgtcgaagccggcatc
gcgcgcgcgatcgagccgccggaagcgctggcacgctatgtggcgaacctcgcaggggtc
gacgcatga

DBGET integrated database retrieval system