KEGG   Erythrobacter litoralis: ELI_11250Help
Entry
ELI_11250         CDS       T00315                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eli  Erythrobacter litoralis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ELI_11250
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ELI_11250
Enzymes [BR:eli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ELI_11250
Two-component system [BR:eli02022]
 CheA family
  CheA-CheYBV
   ELI_11250
Bacterial motility proteins [BR:eli02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ELI_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2275463..2276491)
Genome map
AA seq 342 aa AA seqDB search
MAVRVMIVDDSITARAALARAIDSSGTAKVVGTASSAEVALQLLREQRVDVILLDLEMPG
MGGLEALPRLIEASAGAQILVVSSLTTAGAEPTLAAMAMGAADTLAKPRAGDFNEAYRAE
LLAKLLALAGTADTADLPSSPAVRPATRTIRPELIALGASTGGIHALGRFFAALPQSVTV
PMVLTQHLPHSFMPVFARQVSAMAKRPAAIAADGELIRPNTVMIAPGHAHLEVRRSGGAL
TCALVKFPAPSGCCPSVDPMFESVANVVGHAGLGIVLSGMGRDGALGALQLDRAGGTVLA
QNEDSCAVFGMPRGVVEAGIARAIEPPEALARYVANLAGVDA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccgggtcatgatcgtggacgattcgatcaccgcgcgggctgcgttggcgagg
gccatcgacagcagcggcacggcaaaggtcgtgggcactgccagcagcgccgaagtcgcc
ctgcaattgctgcgcgagcagcgggtcgatgtcatcctgctcgatctcgaaatgcctggc
atgggcggtctcgaggccctgccgcgcctgatcgaggcgtctgcgggggcgcaaattctc
gtcgtctccagtctcaccactgccggagccgagccgacactggccgccatggcgatgggc
gctgccgataccctggcgaaaccccgggccggagacttcaacgaagcctaccgggccgag
ctgctcgccaagctgctagcgctcgctggaactgccgataccgccgatttgccatctagc
ccggcggtccggcccgccacccgcaccatcaggccggaattgatcgcgctaggtgcatcg
accggcggaatccacgcgctcgggcgcttcttcgccgcgcttccacagtctgtcactgtg
ccgatggtgttgacgcaacatctgcctcacagcttcatgccggtattcgcacggcaggtg
agcgccatggccaaacggcccgccgcaatcgccgccgacggcgaacttatccggccgaat
accgtcatgatcgctccgggacatgcccatctggaagtgcgcagaagcggcggtgcgctg
acctgtgccctcgtcaaattccccgcccccagcggatgctgcccttccgtcgatcccatg
ttcgaatccgtcgctaatgtcgttggccacgccgggctcggcatcgtcctgtccggtatg
ggccgcgacggtgctttgggcgcgctgcaactcgatcgggcgggagggaccgtgctcgcc
cagaacgaggacagttgcgcggtgttcggtatgccgcgcggcgtcgtcgaagccggcatc
gcgcgcgcgatcgagccgccggaagcgctggcacgctatgtggcgaacctcgcaggggtc
gacgcatga

DBGET integrated database retrieval system