KEGG   Erythrobacter litoralis: ELI_12310Help
Entry
ELI_12310         CDS       T00315                                 

Definition
phosphomannomutase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eli  Erythrobacter litoralis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ELI_12310
   00052 Galactose metabolism
    ELI_12310
   00500 Starch and sucrose metabolism
    ELI_12310
   00520 Amino sugar and nucleotide sugar metabolism
    ELI_12310
Enzymes [BR:eli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ELI_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2486207..2487088
Genome map
AA seq 293 aa AA seqDB search
MTAHKPIRKAVFPVAGLGTRFLPATKAIPKELLPIVDRPLIQYAVDEAREAGIEQMIFVT
GRGKTAIVEHFDVAYELESTMSERGKDMGVLDPTRATPGDIITVRQQVPLGLGHAIWCAR
AIVGDEPFAIFLPDELMISHQGGAGCMKQMVDAYETRGGNLISVLEVPHDEVSSYGVIDP
GAEHGNLTEVKGLVEKPPVEQAPSNKIVSGRYILQPEVMRILEDQEKGAGGEIQLTDAMA
KMIGQQPFHAVTFDGNRYDCGSKLGFVEATLALALEREDMGAEVRAMAQRLLG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccataaacccattagaaaagccgttttccccgtcgcgggtctcggcacgcgc
ttccttcccgccaccaaggcgatcccgaaagagctcctgccgatcgtcgaccggccgctg
atccagtatgcggtcgacgaagcgcgcgaggcggggatcgagcagatgatcttcgtcacc
ggtcgcggcaagaccgcaatcgtcgaacatttcgacgtcgcctacgagctggaaagcacg
atgagcgagcgcggcaaggacatgggcgtgctcgatcctacccgcgccacaccgggcgac
atcatcaccgtgcgtcagcaggtcccgctgggtctcggccacgcgatctggtgcgcccgc
gccatcgtcggcgacgaacccttcgcaattttcctgcccgacgaactgatgatttcccac
cagggcggcgccggctgcatgaaacagatggtcgatgcctacgaaacccgtggcggcaat
ctgatcagcgtgctcgaagtgccccatgacgaggtctcgagctacggcgtgatcgatccg
ggcgcagagcatggcaatttgaccgaagtgaaaggcctggtcgagaaaccgccggtcgag
caggcaccgtcgaacaagatcgtctcgggccgctacatactccagcccgaggtcatgcgc
attctcgaggaccaggaaaagggcgctggcggcgagatccagctgaccgacgctatggcc
aagatgatcggccagcagccgttccacgcggtcaccttcgatggcaaccgttacgattgc
ggcagcaaactcggcttcgtcgaggcgacgctggcgctggcgctggagcgcgaggacatg
ggcgctgaagtgcgagcaatggcacagcggttgctgggctag

DBGET integrated database retrieval system