KEGG   Erythrobacter litoralis: ELI_12380Help
Entry
ELI_12380         CDS       T00315                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
eli  Erythrobacter litoralis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ELI_12380
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ELI_12380
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ELI_12380
Enzymes [BR:eli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ELI_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2502490..2504148)
Genome map
AA seq 552 aa AA seqDB search
MISTELPAAARLPALDRRGLLKGIGLGAGLVSVPLSARIGERGFTHGVASGEPGATSVLL
WSRYVAEQTTMVAWEVKEADGGQVVAGGEIEASPDSDWCIKPRAEGLRPGAWYLYRFRDA
AGNVSEEGRTRTLPQGAVDRFRMAVFSCANIGYGWFNAYRHAAESNAFDLLVHTGDYFYE
YQPGRYPSADQALPGRFLDPRSETVNLADYRLRHATYRRDPDLRRLTQLYPMILGWDDHE
SANDSYATGAENHQPETEGEWSVRKRAAVRAYREWLPVSDEDWASYEIGDLATIFRLETR
LEARSKQFSIGDVLQEKSSPEEAMRALIAFRDGDYRDPARTVLGAQQETWLADGLRRSKA
AGKTWQVLAQQVLMGSSRTPGSLATAVGDAIPEFARQRLLAAVLAGSAGIPFNMDAWDGY
PAARERLFAASLEAGADLLVLAGDTHNAWAFELDHAGEKVGVEFGGQSVTSPGAESYLSA
IDPRTFASGIVSENPQLKWADTSQRGYLAVELTPERAIADYHFLGSIRQQGTALAGTKRI
TSVAGSRTLDIG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaccgaactgcccgccgccgcccgattgcccgcgctcgaccggcgcggcctg
ctcaagggcatcggcctcggcgccgggctggtttcggtgccgctctcggcacggatcggc
gagcggggcttcacccatggcgtcgccagcggcgaacccggcgccacgtcagtgctgcta
tggtcgcgctacgttgccgagcaaacgaccatggtggcgtgggaggtgaaggaagccgac
ggcggccaggtcgtggcgggcggggaaatcgaagcttcgccggacagcgactggtgcatc
aagcccagggcggaaggtctgcgtccgggcgcctggtatctctatcgcttccgcgacgcc
gccgggaatgtgtcggaggaagggcgcacgcgcacgctgccgcagggcgcggtcgaccgc
ttccgcatggcggtcttctcctgcgccaatatcggctacggctggttcaacgcctaccgc
cacgccgccgaaagcaacgccttcgacctgctggtccataccggcgactatttctacgaa
taccagccgggacgctatccctccgccgaccaagcgctgcccggccgcttcctcgacccg
cgctcggaaaccgtcaacctggccgattatcgcttgcgccatgcgacctatcgccgcgat
ccggatttgcgccgcctgacccagctttatccgatgatcctaggctgggacgaccacgaa
agcgccaacgacagctacgcgaccggcgccgaaaaccaccagcccgagaccgaaggcgaa
tggagtgtgcgcaaacgggcggcggtgcgcgcctatcgcgaatggctgccggtgagcgac
gaggactgggcgagctacgagatcggcgatctcgccacgatcttccgcctcgaaacgcgg
ctcgaggcccgttccaaacagttcagcatcggcgatgtgctgcaagaaaaatcgtcgccc
gaagaggccatgcgagccctgatagcattccgggatggcgactatcgcgatccggcacgc
acggtgctgggtgcccagcaggagacatggctcgccgatggtctcaggcgctcgaaagcg
gcgggcaagacttggcaggtgctcgcgcagcaggtgttgatgggatcctcgcgtacgccg
ggttcgctcgccaccgccgttggcgatgccatccccgaattcgcgcgccagcgcctgctg
gccgcggtgctggcggggtccgccggcatacccttcaatatggacgcatgggacggctat
cccgcagcgcgcgagcgcctgttcgcggcatcgctcgaggccggtgccgatctgttggtg
ctggcgggcgacacgcataatgcgtgggcattcgagctcgatcatgcgggcgaaaaggtc
ggcgtcgaattcggcggacagagcgtcacgtcgccgggcgccgaaagctacctgtcggcc
atcgatcccaggacctttgcgagcggcatcgtttccgagaacccgcagctcaaatgggcc
gacacctcgcagcgcggctatctcgcggtcgaactgacgcccgaacgcgcaattgcggac
tatcatttcctcggctcgatccgccaacagggcaccgcgctcgccgggaccaagcgcatc
acctctgttgcgggcagccggacgctcgacatcggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system