KEGG   Erythrobacter litoralis: ELI_12565Help
Entry
ELI_12565         CDS       T00315                                 

Definition
asparagine synthetase-like protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
eli  Erythrobacter litoralis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ELI_12565
Enzymes [BR:eli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ELI_12565
Peptidases [BR:eli01002]
 Cysteine Peptidases
  Family C44
   ELI_12565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2541129..2543006
Genome map
AA seq 625 aa AA seqDB search
MFAVVSSPGAVPHDLAQALDSWLASYGLDRQVHTLPHAVILAAPSRCAIGARTVLDGWID
NCSELGTELGVSSENPAAIYDAALARWGVYADRHVVGQYVAATVFDSGDIRLSRSPLAAP
PVHWTCHGGLVIAGTLPTLFPRLGIALELDLDRVADLLAIDHGCEPGASHYLGIERLRQG
AIAEVGRDRTRVEHWYGPDCIADIAVSTDAETLEQTEALLGEACRAALSRSKRPVTSLSG
GLDSPLVASELLAQMPDEQRLPSITFVPGPDWHGRDHVGKVGDEWPAVQRFAAMHPRLDP
HRADGSIGEFDHKFREIAALAGTLNPGLAHFGPHHGVWQKARDLGCDWLFGAGFGNQTIS
RDGRWAYAQYLRELKWGEMIRALRGRTYDHRSLPHKLLALSVLPNLPQKLRSVIKGTLRP
ERRDGLQWASLLSREARERFRKRAEKRRSHPEWEGFSYAASREEALRRDLRAQDHEANEI
TVALELHYGLRYHDITTYRPLAEFCFGLPTEQFMRQGEHRSLARRLAKGRMPESQRTSTL
YGAPMPDWHARLKNRREELLQQVDALGRSAAVRSLLDIDRMRTMLEQLPDEHPQDQFVDM
PYIQGLPMALVTAQFIAMSEGRNDI
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgtcgtatccagccctggcgccgttccgcacgatctagcgcaagcacttgac
agctggctggcaagttatggcctcgaccgtcaggtccacacactcccacatgcggtaatt
ctagcggcaccgtcccgatgcgccatcggtgcccgcaccgtcctcgacggctggatcgac
aattgctccgaactcggcaccgaattgggcgtctcgtccgaaaacccggcagcgatctac
gatgccgcgctcgcgcggtggggcgtgtatgcagaccggcatgtcgtcggccagtacgtg
gccgctaccgtgttcgatagcggggatatccgcctgtcgcgctcgccgctggcggcgccg
ccggtccactggacttgccatggcgggttggtgatcgccggcaccctgccgaccctgttt
ccccggctgggcatcgcgctcgaactggacctggaccgtgtcgcagacctgctcgccatc
gatcatggctgcgaaccgggcgcgagccattatctgggcatcgagcgactgcggcagggt
gcaatcgcagaggtgggtcgggaccggacgcgcgtcgagcactggtacggccccgattgc
atcgccgacatcgccgtcagcaccgatgccgagacgctggagcaaaccgaagcactgctg
ggcgaggcgtgccgggcggcgctttcccgcagcaagcggcccgttaccagcctttccggc
ggcctcgattccccgctcgtggccagcgaattgctcgcgcagatgccggacgaacagcgc
ctgcccagtatcaccttcgtgcccggccccgactggcacgggcgcgaccatgtcggaaag
gtcggcgacgaatggcccgccgtgcagcgctttgccgccatgcatccgcgtctcgacccc
caccgcgccgatggcagcatcggcgagttcgatcacaaatttcgcgaaatcgccgcgctt
gcaggcactcttaatcctggccttgcgcatttcggcccgcaccacggggtctggcagaag
gcgcgcgatctgggctgcgactggctgttcggggcgggcttcggcaaccagacgatcagc
cgcgacggccgctgggcctatgcgcagtatttgcgcgaactgaaatggggagagatgatc
cgcgcgttgcggggccgcacctacgatcatcgctcgctgccgcacaaattgctggcgctg
tcggtactgcccaacctgccgcagaagctgcgcagcgttatcaagggcacattgcgcccc
gaacggcgcgacgggttgcaatgggcttcgcttctatcccgcgaggcgcgagagcggttt
cgcaagcgcgccgaaaagcgccggtcgcatcccgagtgggaggggttttcctatgccgcc
agccgcgaagaggccctgcgccgcgacctgcgcgcgcaggatcacgaagcgaacgagatc
actgtcgcgctcgagttgcattacgggctgcgctaccacgatatcacgacctaccggccg
ctcgcggaattctgcttcggattgccgacggagcagttcatgcggcagggcgagcatcgc
tcgctggcgcggcggctcgcgaaagggcgcatgccggagagccagcgcaccagtacgctc
tacggcgcgccgatgcccgactggcatgcacgactgaagaaccggcgcgaggaactgctg
cagcaggtcgatgcgcttggccgaagtgccgccgtgcgcagcctgctcgacatcgacagg
atgcgcacgatgctggagcaattgccggacgagcatccgcaggaccagttcgtcgacatg
ccgtatatccagggattgccgatggcgctggtgacggcacagttcatcgcgatgtccgaa
gggcgcaacgacatctga

DBGET integrated database retrieval system