KEGG   Erythrobacter litoralis: ELI_12910Help
Entry
ELI_12910         CDS       T00315                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
eli  Erythrobacter litoralis
Brite
Enzymes [BR:eli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ELI_12910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2604222..2604821
Genome map
AA seq 199 aa AA seqDB search
MIDTATRPIDYAAARRAMIDSQLRTSGVNSTAVLARMLSVPREDHVPASARGHCYMDRAI
ALDNGGTLAQPVSHGKMLSEARPNLEDSALIVENGSGYLAALVEPMVAKLDTVSAEDAAT
GKKRGSYSLILIDGAIEACPAALAKRLDENGRMVTGLIEDGVTRLAIGKRQGKDMAFLPV
ADVALPRLPAFDSPKGWSF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatactgccacccgccccatcgactatgccgccgcccgtcgcgcgatgatcgac
agccagctgcgcaccagcggcgtcaattcgaccgctgtgctggctcggatgctgtccgta
ccgcgcgaggatcacgtgcccgcgagcgccaggggccattgctacatggaccgcgcgatc
gcgctcgataatggcggcacgctggcacagccggtctcgcacggcaagatgctgagcgaa
gcgcggccgaacctcgaagacagcgcgctgatcgtcgagaacggctcgggctacctcgcg
gcgctggtcgaaccgatggtggcgaagctggacactgtttcggccgaagatgccgcaacg
ggcaagaagcgcggcagctacagcctgatcctgatcgacggcgcgatcgaagcctgccct
gcggccctggccaagcggctcgacgagaacggtcgcatggtcactggcctgatcgaagac
ggcgtgacccgcctcgcgatcggcaagcggcagggcaaggacatggcattcctcccggtc
gccgacgttgcgctaccgcgcctcccggctttcgatagcccgaaaggctggagcttctga

DBGET integrated database retrieval system