KEGG   Erythrobacter litoralis: ELI_13145Help
Entry
ELI_13145         CDS       T00315                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eli  Erythrobacter litoralis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ELI_13145
Enzymes [BR:eli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ELI_13145
Exosome [BR:eli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ELI_13145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2647069..2648001
Genome map
AA seq 310 aa AA seqDB search
MFRETVLTPADLIWPLFIIEGEGQEEPVESLPGVSRWSVDGIVARAKEAIDLGIPCIALF
PNTPSKLRSDDGREAYNPDNLMCRAIKAVRDACGSDIGILTDVALDPYTSHGQDGLLDNA
GYVVNDDTVAVLVDQAVNQAEAGADIIAPSDMMDGRVKAIRMALEMGEHPNVQIMAYAAK
YASAFYGPFRDAVSSGGLLKGDKKSYQMDPANALEALREIELDIAEGADSVMVKPGLAYL
DIIWRAKEAFGVPVFAYQVSGEYALIEAGAAAGVGDRDALMMEKLIAFKRAGCAGVLTYH
APVAAKMLDG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgaaaccgtgcttacgccagccgacctgatctggccattgttcatcatcgag
ggtgagggacaggaggagccggtcgagagcctccccggcgtttcgcgctggtcggtcgac
gggattgtcgcgcgggccaaagaggcgatcgacctgggcatcccgtgcatcgcgctgttt
cccaacacgccgagcaagttgcgcagcgacgatggcagggaagcgtacaatcccgacaat
ctgatgtgccgcgcgatcaaggcggtacgcgatgcttgcggcagcgatatcggcatcctc
accgatgtcgcgctcgatccctataccagccacgggcaagacggcttgctcgacaatgcg
ggctatgtcgtcaatgacgataccgttgccgtgctggtcgaccaggccgtcaatcaggcc
gaagcgggggccgatatcatcgctccgtcggacatgatggatggacgggtcaaggccatc
cgcatggcgctggagatgggcgagcatcccaatgtccagatcatggcctatgccgcgaaa
tatgcctcagccttttacggaccgtttcgcgatgcggtcagcagcggcgggctgctcaaa
ggcgacaagaaaagctaccagatggatccggccaatgcgctcgaggcactgcgcgagatc
gagctggacatcgccgagggcgccgatagcgtgatggtcaagcccggcctcgcctatctc
gatatcatctggcgcgcgaaggaagctttcggcgtgccggtgttcgcttaccaggtcagc
ggcgaatacgcgctgatagaagcgggtgctgcggcaggcgtcggcgatcgcgacgcgctg
atgatggaaaaacttattgccttcaagcgggccggttgtgcgggggtcctgacgtatcac
gcaccggtcgctgccaaaatgctcgatggctga

DBGET integrated database retrieval system