KEGG   Erythrobacter litoralis: ELI_13570Help
Entry
ELI_13570         CDS       T00315                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eli  Erythrobacter litoralis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ELI_13570
   00670 One carbon pool by folate
    ELI_13570
Enzymes [BR:eli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ELI_13570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2735499..2735969)
Genome map
AA seq 156 aa AA seqDB search
MIYARAANGTIGKDGGMPWHLPTDLKRFKRLTTGHVLIMGRKTFESFPDPLPGRRHIVLT
RDEDWGADGAEVAHSRAEALQLAGEEPVAIIGGAEVYALFEQEAERIELTQIHAKYEGDT
FMDAPGPDWREIARDEYEAEDGRPAFSFVTFLRAER
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgcccgcgccgccaatggcacgatcggcaaggacggcggcatgccctggcac
ttgccgaccgacctcaagcgcttcaagcggctgaccaccggccatgtcctgatcatgggc
cgcaagaccttcgagagctttcccgacccgctgcccggtcgccgccatatcgtgctgacg
cgcgacgaggactggggggcggacggcgcagaagtggcgcattcgcgcgccgaagcgctg
caactggcgggcgaggagccggtcgccatcatcggcggcgcggaggtttatgcgctgttc
gagcaggaagccgaacgcatcgagctgacccagattcacgcgaaatacgaaggcgacacc
ttcatggacgcgcccggccccgactggcgcgagatcgcgcgtgacgaatacgaggccgaa
gatggtcgacctgccttctctttcgtcacctttctgagagcagagcgatga

DBGET integrated database retrieval system