KEGG   Escherichia coli W: WFL_02110Help
Entry
WFL_02110         CDS       T02101                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ell  Escherichia coli W
Pathway
ell00360  Phenylalanine metabolism
ell00362  Benzoate degradation
ell00620  Pyruvate metabolism
ell00621  Dioxin degradation
ell00622  Xylene degradation
ell00650  Butanoate metabolism
ell01100  Metabolic pathways
ell01120  Microbial metabolism in diverse environments
ell01220  Degradation of aromatic compounds
Module
ell_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ell00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WFL_02110 (mhpF)
   00650 Butanoate metabolism
    WFL_02110 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    WFL_02110 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WFL_02110 (mhpF)
   00622 Xylene degradation
    WFL_02110 (mhpF)
   00621 Dioxin degradation
    WFL_02110 (mhpF)
Enzymes [BR:ell01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     WFL_02110 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFH10093
UniProt: E0J0Q0
Position
451944..452894
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcg
ggcgcgcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system