KEGG   Escherichia coli W: WFL_04525Help
Entry
WFL_04525         CDS       T02101                                 

Definition
putative lysozyme protein R of prophage
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ell  Escherichia coli W
Brite
Enzymes [BR:ell01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     WFL_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976027..976539
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERSLERCVKQQPPQKVYDAVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagcttcacacctccgtggaggggctgaaactgattgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattggt
aatacatctggcgtcattccaggcaaaaccattacggaacgacaggcagcggaaggactg
atctccaacgtgctgcgtgtggagcggtcactggaaaggtgtgtgaagcaacagccaccg
cagaaggtgtatgacgcggtggtgtcatttgccttcaacgtgggaacgggcaatgcctgc
agctccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtaaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgtttacagggagcaaactga

DBGET integrated database retrieval system