KEGG   Escherichia coli W: WFL_07860Help
Entry
WFL_07860         CDS       T02101                                 

Gene name
adhP
Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ell  Escherichia coli W
Pathway
ell00010  Glycolysis / Gluconeogenesis
ell00071  Fatty acid degradation
ell00350  Tyrosine metabolism
ell00625  Chloroalkane and chloroalkene degradation
ell00626  Naphthalene degradation
ell01100  Metabolic pathways
ell01110  Biosynthesis of secondary metabolites
ell01120  Microbial metabolism in diverse environments
ell01130  Biosynthesis of antibiotics
ell01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ell00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WFL_07860 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    WFL_07860 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    WFL_07860 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WFL_07860 (adhP)
   00626 Naphthalene degradation
    WFL_07860 (adhP)
Enzymes [BR:ell01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     WFL_07860 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AFH11234
UniProt: E0J6E3
Structure
PDB: 

Jmol
Position
complement(1658321..1659331)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcacgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaactggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaatagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgctctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagttgctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgttaa

DBGET integrated database retrieval system