KEGG   Escherichia coli W: WFL_08675Help
Entry
WFL_08675         CDS       T02101                                 

Gene name
folM
Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ell  Escherichia coli W
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ell00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ell00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1823833..1824555
Genome map
AA seq 240 aa AA seqDB search
MGKAQPLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGTPLADVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHVAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagcccagcccttgccaatattaattactggcggaggtcgtcgcatcggcctc
gccctcgcctggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatccagccattgatggactgattaaggcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagtgcgtggatggcggaaaaaccaggtacaccactggccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgcgctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatgttgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgccgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtttcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system