KEGG   Escherichia coli W: WFL_09505Help
Entry
WFL_09505         CDS       T02101                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ell  Escherichia coli W
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ell00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    WFL_09505 (pncA)
Enzymes [BR:ell01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     WFL_09505 (pncA)
    3.5.1.-  
     WFL_09505 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1994622..1995263
Genome map
AA seq 213 aa AA seqDB search
MPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAPLHPLLNQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccccatcgcgccctattactggtcgatttacaaaatgatttctgtgctggtggcgcg
ctcgccgtaccggaaggtgacagtacggtggaggttgctaaccgccttattgactggtgc
cagtcgcgcggagaagcggttatcgccagccaggactggcatccggcgaatcacggcagt
tttgccagtcagcacggtgtagagccttatacgccaggccaactcgacggtttgccacaa
accttctggccagatcactgtgtgcagaacagtgaaggcgcaccattacatccgttactg
aaccaaaaagcgatcgcagcggtgttccataaaggcgaaaatcctttagttgacagttac
agtgccttttttgataacggccgtcggcagaaaacctctctcgatgactggttacgcgat
catgaaatcgatgaattgatcgttatgggcctggctactgactattgcgtgaagtttacc
gtgctggacgcgttacagttaggttataaggtgaacgtgattaccgatggttgtcgtggc
gtgaatatccagccccaggacagtgcgcacgcgtttatggagatgtcagcagctggggca
acgctatatacgctggcagactgggaagagacgcaggggtaa

DBGET integrated database retrieval system