KEGG   Escherichia coli W: WFL_12860Help
Entry
WFL_12860         CDS       T02101                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ell  Escherichia coli W
Pathway
ell00010  Glycolysis / Gluconeogenesis
ell00052  Galactose metabolism
ell00500  Starch and sucrose metabolism
ell00520  Amino sugar and nucleotide sugar metabolism
ell00521  Streptomycin biosynthesis
ell01100  Metabolic pathways
ell01110  Biosynthesis of secondary metabolites
ell01120  Microbial metabolism in diverse environments
ell01130  Biosynthesis of antibiotics
ell01200  Carbon metabolism
Module
ell_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ell_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ell00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WFL_12860 (glk)
   00052 Galactose metabolism
    WFL_12860 (glk)
   00500 Starch and sucrose metabolism
    WFL_12860 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    WFL_12860 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WFL_12860 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    WFL_12860 (glk)
Enzymes [BR:ell01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     WFL_12860 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AFH12230
UniProt: E0J7K1
Structure
PDB: 

Jmol
Position
complement(2689495..2690460)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HNNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtcgaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggtcctgggctggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgtgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcattaacgctgggaacctttggtggggtttatatt
gctggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
cataacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system