KEGG   Escherichia coli W: WFL_13745Help
Entry
WFL_13745         CDS       T02101                                 

Gene name
ung
Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ell  Escherichia coli W
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ell00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    WFL_13745 (ung)
Enzymes [BR:ell01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     WFL_13745 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2884252..2884941
Genome map
AA seq 229 aa AA seqDB search
MANELTWHDVLAEEKQQPYFLNTLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVI
LGQDPYHGPGQAHGLAFSVRPGIATPPSLLNMYKELENTIPGFTRPNHGYLESWARQGVL
LLNTVLTVRAGQAHSHASLGWETFTDKVISLINQHREGVVFLLWGSHAQKKGAIIDKQRH
HVLKAPHPSPLSAHRGFFGCNHFVLANQWLEQRGETPIDWMPVLPAESE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctaacgaattaacctggcatgacgtgctggctgaagagaagcagcaaccctatttt
cttaatacccttcagaccgtcgccagcgagcggcagtccggcgtcactatctatccacca
caaaaagatgtctttaacgcgttccgctttaccgagttgggtgacgttaaagtggtgatt
ctcggccaggatccttatcacggaccgggacaggcgcatgggctggcattttccgttcgc
cccggaatcgccactcctccgtcactgctgaatatgtataaagagctggaaaatactatt
ccgggcttcacccgccctaatcatggctatctcgaaagctgggcgcgtcagggcgttctg
ctgctcaatactgtgttgacggttcgcgcaggtcaggcgcattcccacgccagcctcggt
tgggagacgtttactgataaagtcatcagcctgattaaccagcaccgcgaaggcgtggtg
tttttgttgtggggatcacatgcgcaaaagaaaggggcgattatagataagcaacgccat
catgtactgaaagcaccgcatccgtcgccgctttcggcgcatcgtggattctttggctgc
aaccattttgtgctggcaaatcagtggctggaacaacgtggcgagacgccgattgactgg
atgccagtattaccggcagagagtgagtaa

DBGET integrated database retrieval system