KEGG   Eubacterium limosum: ELI_0277Help
Entry
ELI_0277          CDS       T01336                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
elm  Eubacterium limosum
Pathway
elm00010  Glycolysis / Gluconeogenesis
elm00020  Citrate cycle (TCA cycle)
elm00620  Pyruvate metabolism
elm00633  Nitrotoluene degradation
elm00640  Propanoate metabolism
elm00650  Butanoate metabolism
elm00680  Methane metabolism
elm01100  Metabolic pathways
elm01120  Microbial metabolism in diverse environments
elm01130  Biosynthesis of antibiotics
elm01200  Carbon metabolism
Module
elm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_0277
   00020 Citrate cycle (TCA cycle)
    ELI_0277
   00620 Pyruvate metabolism
    ELI_0277
   00640 Propanoate metabolism
    ELI_0277
   00650 Butanoate metabolism
    ELI_0277
  Energy metabolism
   00680 Methane metabolism
    ELI_0277
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ELI_0277
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ELI_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADO35296
UniProt: E3GI11
Position
260250..260798
Genome map
AA seq 182 aa AA seqDB search
MIEIRWHGRGGQGAFTAARLLGDAVVCDDKSALAFPSFGPERRGAPVLAFTRIDDAPIKD
RSDVVDCDCAIVLDETLLGAPVKAGLKPGAKVIINTMKPAEVFDFSDCEDCKVITVDATG
LALKILGRPITNVPLLGALTAATELTSLDSIYKAIDTQLPEKVRAKNKTLLEETYNTVKE
AL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcgttggcatggtcgtgggggacaaggtgccttcacagcagcccggctc
ttgggagatgccgttgtgtgcgacgataaatcggcgttggcttttccatcgttcggacca
gaacgcaggggggctccggtattagcttttacacgaattgatgatgcgccaatcaaggat
agaagcgatgttgtcgattgtgattgtgccattgtgttggatgagacgcttttaggcgcg
ccggttaaggcggggttaaagcctggggcaaaggtgattatcaatacaatgaagcctgca
gaggtatttgatttcagcgactgtgaggactgcaaggttattaccgtcgatgcgacaggc
cttgcgctgaaaatccttggacggcccatcacaaatgtccctttattgggcgcgctgaca
gcggccacagagctgacaagccttgactccatctataaggccattgatacgcagctccct
gaaaaggtgcgggcaaaaaataaaacgcttttggaagaaacctataatactgtaaaggag
gcactctaa

DBGET integrated database retrieval system