KEGG   Eubacterium limosum: ELI_0278Help
Entry
ELI_0278          CDS       T01336                                 

Definition
(RefSeq) pyruvate ferredoxin/flavodoxin oxidoreductase
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
elm  Eubacterium limosum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_0278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_0278
   00020 Citrate cycle (TCA cycle)
    ELI_0278
   00620 Pyruvate metabolism
    ELI_0278
   00640 Propanoate metabolism
    ELI_0278
   00650 Butanoate metabolism
    ELI_0278
  Energy metabolism
   00680 Methane metabolism
    ELI_0278
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ELI_0278
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ELI_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260799..261101
Genome map
AA seq 100 aa AA seqDB search
MNRPKLSPPQPSGTIEQLPMGPSTRSGHLIDVSSGMRTFRPVIDAEKCVNCLRCFLVCPD
GTIDKSGDILEIDYDYCKGCGVCAKACKVEAITMIKEADA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgacctaaattatcgccgccacagccgtcaggcacgatcgagcagctgcccatg
gggccgtcgacacgttcgggccatctgattgacgtgagctcagggatgcggacattccgg
ccggtgatcgacgcggaaaaatgtgttaactgcctgcgctgctttttagtgtgtcccgat
ggcaccattgataaatcaggagatatccttgaaatagattatgattactgtaaaggctgc
ggcgtatgtgcgaaagcatgtaaggttgaggccattacgatgattaaggaggcagacgca
tga

DBGET integrated database retrieval system