KEGG   Eubacterium limosum: ELI_0278Help
Entry
ELI_0278          CDS       T01336                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase
Organism
elm  Eubacterium limosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260799..261101
Genome map
AA seq 100 aa AA seqDB search
MNRPKLSPPQPSGTIEQLPMGPSTRSGHLIDVSSGMRTFRPVIDAEKCVNCLRCFLVCPD
GTIDKSGDILEIDYDYCKGCGVCAKACKVEAITMIKEADA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgacctaaattatcgccgccacagccgtcaggcacgatcgagcagctgcccatg
gggccgtcgacacgttcgggccatctgattgacgtgagctcagggatgcggacattccgg
ccggtgatcgacgcggaaaaatgtgttaactgcctgcgctgctttttagtgtgtcccgat
ggcaccattgataaatcaggagatatccttgaaatagattatgattactgtaaaggctgc
ggcgtatgtgcgaaagcatgtaaggttgaggccattacgatgattaaggaggcagacgca
tga

DBGET integrated database retrieval system