KEGG   Eubacterium limosum: ELI_0279Help
Entry
ELI_0279          CDS       T01336                                 

Definition
(RefSeq) pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
elm  Eubacterium limosum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_0279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_0279
   00020 Citrate cycle (TCA cycle)
    ELI_0279
   00620 Pyruvate metabolism
    ELI_0279
   00640 Propanoate metabolism
    ELI_0279
   00650 Butanoate metabolism
    ELI_0279
  Energy metabolism
   00680 Methane metabolism
    ELI_0279
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ELI_0279
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ELI_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
261098..262282
Genome map
AA seq 394 aa AA seqDB search
MSEKLFVSGDEAVALAVRQAKPHVIAAYPITPQTIVVERLADYVEDGSLDCQYMYVESEH
SAMSAVIGSAAMGARSFTATSSQGLLYMVEGLHYASGSRFPIVMMNANRSLAAPWNIYGD
QRDSLSQLESGWIQLYVENVQEAFDTTIQAFKIAEDPEVMTPVMVNLDGFVLTHTYEPLE
MTDQAAVDAYIPYQDYINKLNLEDPVSTCITAGPTYNTEFRYQQQIAMLKAEKVIDESDE
EFGRLFGRTYGGMVEAYQCEDAEAILVTIGSVTGTARVVVDACRAEGKKVGLLKLRCVRP
FPTEKVAEIVKNAKAVGVMERDISFGFEGAVYSDFNSALKQQGVDVPTCNYVGGLGGRSI
SKEDISGIFDALLAGNTEKPVEFINVRRDIDYGA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaattatttgtatccggcgacgaggctgtcgcattggcggtcagacaggca
aaaccacatgtgattgccgcttaccccatcacacctcagacaattgtagtagaacgtctg
gcggattatgtagaggatggcagtcttgactgccagtacatgtatgtggaatctgaacac
agcgccatgtcggctgttatcggctccgcagccatgggcgcccgctcctttaccgcaaca
tcgagccaggggcttttatacatggttgaaggcctgcactatgccagcggttcccgtttt
ccaattgttatgatgaacgcaaaccgttcactggcagcgccctggaatatttacggtgat
cagagagactctttatctcagctggaatcaggctggattcaactatatgttgaaaacgtt
caagaagcctttgataccaccattcaggctttcaaaatcgccgaggatcctgaggtcatg
acgccggtcatggtcaacctggatggttttgttttaacccatacctacgagcctcttgag
atgaccgatcaggcggcagtagatgcgtatatcccttatcaggactacatcaataagctt
aatctggaggacccggtgagcacctgtattactgcgggaccgacctataatacagagttc
cgttatcagcagcagatcgcaatgctgaaggctgagaaagtgattgacgaaagtgacgag
gaattcggcaggcttttcggacgcacctacggtggtatggtagaagcataccagtgtgag
gatgcggaagcaatcttggtgacaatcggcagtgtgacgggaacagcccgcgtggttgtg
gatgcctgccgcgcagaaggtaaaaaggtcggtttgctgaagctccgctgtgtacgccca
ttcccaacggaaaaggtagcagagatcgttaaaaacgctaaagcggtcggtgtcatggaa
cgtgatatcagctttggatttgaaggcgcagtctactctgattttaactctgccctcaaa
cagcagggtgtggatgtaccgacctgtaattatgttgggggcttaggcggccgcagcatc
tcaaaggaagatatcagcggtatttttgacgcactgctggcaggcaatactgaaaagcct
gttgaattcattaatgtaaggagggacattgattatggcgcttaa

DBGET integrated database retrieval system