KEGG   Eubacterium limosum: ELI_0280Help
Entry
ELI_0280          CDS       T01336                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Organism
elm  Eubacterium limosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262272..263162
Genome map
AA seq 296 aa AA seqDB search
MALNAKTIPNEELFYGHKACGGCGGALAIRLALKVLGERSIAVIPPNCMSTVAFVYPHMP
LFVNGIIPPFAATAAVMSGVLAGAKALGLEDYHVVGFAGDGGTSDIGLQALSGAIDRNDK
EIFICYDNEAYMNTGIQKSGLTPYGAKTTNTPAGKNIHGAARPKKKIFEIIAAHEIPYAA
TASVGYPEDYLRKLEKAKNCDGPSFIHVLAPCPTGWQTPTDISIELAKEAVDNGLWYLAE
YENKEFTLNRNPKEFTDISDYLSKQGRFSHLDENDIALITEGRDETWEKIRRDWVK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaatgcaaaaacaatcccaaatgaagaactgttttatggtcataaggcctgt
ggcggctgcggcggagcccttgcgattcgtctggcccttaaggtgctgggagaacgaagc
attgcggttattccgccgaactgcatgtcaacggttgctttcgtatatccgcatatgcca
ttgtttgtcaatgggattatacctccctttgccgcaactgcggcagtgatgtccggtgtt
ttggcaggagcaaaggccctggggcttgaggactaccatgtcgttggctttgccggagac
ggcggcacctccgatattggcctgcaggctctgtcgggtgctattgaccgtaacgataag
gaaatttttatctgctacgacaatgaagcttacatgaacaccggaatccagaaaagtggc
ttaacgccctatggagcaaagaccacaaacacgcctgcaggaaaaaatattcacggcgcg
gcgcggccaaagaaaaaaatctttgagatcattgcagcccatgaaatcccatatgcggct
actgccagtgtcggctatccggaagattatttgagaaaactggaaaaagccaagaactgt
gatgggccttcctttatccacgtactcgccccctgcccgacaggctggcagacacccacg
gatatttcaatcgagctggcaaaagaagctgtcgataacggcctgtggtatctggcagaa
tatgaaaacaaggaatttacactcaaccgcaaccctaaagagtttaccgatatttcggat
tatctctcaaagcagggccggttttcacatctcgatgaaaatgacattgcacttatcacc
gaaggcagagatgaaacctgggaaaaaatacgcagagattgggtgaaatag

DBGET integrated database retrieval system