KEGG   Eubacterium limosum: ELI_0307Help
Entry
ELI_0307          CDS       T01336                                 

Definition
putative succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
elm  Eubacterium limosum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_0307
  Amino acid metabolism
   00300 Lysine biosynthesis
    ELI_0307
Enzymes [BR:elm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ELI_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(288893..290041)
Genome map
AA seq 382 aa AA seqDB search
MHIINAQTLTQELVRIDSSDPGAYEGAISLKIVELLESAGVPVVKEEVLPGRFNVMGKIK
GEIDDPALIYICHMDTVTLGEGWSIPPLSAKIKDGRLYGRGACDMKSGLACALSAFLKAA
VSGKQPRHSFVFIGTIDEEYYMRGVEAAIASGWVTEKSWVLDTEPTNGQIQVAHKGRTWF
ELTADGVTAHASTPWKGADAISAMAEMIVAVRKGIEATAPHHDLGRSTVTFGQINGGYRP
YVVPDHCTVTIDMRLVPPITTAAAESIVKSAICRAEKQIPGVHGHYKITGDRPFVEKDGH
SYLLKMLRESCAAVTGSPAQVSFFPGYTDTAVIAGKLNNHNCLSYGPGDLELAHKPDEYV
PLADIARCENVLTDLADRMLFV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcataaacgcgcagacactgacccaagagcttgtccgtatcgacagctcagat
cccggcgcatacgagggggccatcagccttaaaatcgtagagcttctggaatcagcgggc
gttcctgttgtcaaagaagaggttctgcccggccgttttaatgtcatgggcaaaatcaaa
ggagaaattgacgatccagcgcttatttatatctgtcatatggatacagtgacattggga
gagggctggagtattccgccactctctgccaaaataaaagacggacggctttacggcaga
ggcgcctgcgatatgaaatccggcctggcctgcgccctttccgcttttctaaaagccgct
gtttctggaaaacaaccgcgccactcctttgttttcatcggaacaatcgatgaagaatac
tatatgcgcggtgtggaagctgccatcgcctcaggctgggtaactgaaaaaagctgggtg
ttggacaccgaacccacaaacgggcaaattcaggttgcccacaaaggccgcacctggttt
gaactgacggcagacggcgtaaccgcccatgccagcacaccctggaaaggggcggacgcc
atttctgccatggcagaaatgatcgttgctgtgcggaaaggaattgaggcaacagcaccc
catcatgacctcggccgctccacagtcactttcgggcagatcaatggcggctatcgccca
tacgtagtcccggaccactgcacagtcaccattgatatgcgcctcgtgccgcctatcacc
actgctgctgcggaatccattgtaaaatcagccatatgccgggcagaaaagcagattcct
ggcgtccatggtcattataaaattaccggtgaccgtccttttgttgaaaaagatgggcac
tcctaccttttaaaaatgttgagagaaagctgcgcagccgtaaccggcagccctgcccaa
gtcagctttttcccaggctataccgataccgccgttatcgcgggaaaactgaataaccac
aattgcctttcctacggccccggcgaccttgaactggcccacaaacccgatgagtacgtt
cctctggccgatatcgcccgatgcgaaaatgtactgaccgacctggcagacaggatgctg
tttgtctaa

DBGET integrated database retrieval system