KEGG   Eubacterium limosum: ELI_0332Help
Entry
ELI_0332          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
elm  Eubacterium limosum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_0332
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ELI_0332
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ELI_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315227..317119
Genome map
AA seq 630 aa AA seqDB search
MKPLNYLHINLSTGKIRPLPIKEGVVRAYLGGKTLAAKLLYDLLPKGVDPLSKENILIIN
TGIMTDTGAPSSSRFNMTFKNVMTGGIASSNCGGSFGMMMRRAGVDGLILVGGAEKPVYL
EILDGEVTIRDAENLWGLDAEAVQERFPKIYGKVVIGPAGENRVRYACAVSGERVAGRCG
CGAVMGVKNLKGIVAYGTKRPELYNKPAFDAYVKKWVKFIQNHPMTGDSLPHYGTAGLVN
NANASHALPTHNFKRGQFEAAEEICGETLADKYLTRNSGCVSCPIRCERRVMVDGREVKG
PEFETVGLFGSNIENSNLELINEINYKADILGLDTISLAGTLAFAMELQEREMADFGLRF
GETGNLLEIIEKIAYRQDIGDELAEGSARLAQKYGGADFAINAKGMELASYEPRRSVGMG
LGYATSNRGGCHLNGGYLALMESVGVMSVGAQGTKGKPELTAFMQNGMEAGSAAGFCLFT
MQTMIPSILYHMGPVSPVTHTAGKAMIMARGVLGNMWPLMPGLLPVKTMYLMPHCKAIEL
ATGMRMTTGEFLQVGERGFTIERLFNLREGLTAENDSLPGRLTDELQEPTDPSTRVDLET
MLPVYYKVRGWDERGVPTWPTLKRLGLGSL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctttgaattatttgcatattaacctgagcacaggtaaaatacgcccgctgccc
atcaaagaaggggttgtgagggcatatctaggcggtaaaacgctggcagccaagctgctt
tatgatttgctgccaaagggtgtagaccctctgtcaaaagaaaatattctgattatcaac
acaggaattatgacggacactggtgcgccctcatccagtcgttttaacatgacctttaaa
aatgtgatgactgggggaatcgcctcatccaactgcggcggaagctttggtatgatgatg
cggcgcgccggagtggacgggcttattctggtgggcggagcagaaaaaccggtatatctg
gaaattctggacggcgaggtgacgattcgtgacgcagaaaacctgtgggggctggatgcc
gaggctgttcaggaacgctttcccaagatttatgggaaggtggtcatcgggccggccgga
gaaaatagggtgcgctatgcctgcgctgtttcaggcgaacgggtagccggacgatgcggc
tgcggcgcggtaatgggcgttaaaaatttgaaaggtattgtggcttatggaaccaaacgg
ccagagctttacaacaaaccagcttttgacgcctatgtgaaaaagtgggtgaaattcatt
cagaatcatcccatgacgggtgacagcctgccccattacggtactgccggtctggtaaat
aacgccaatgcctcacacgcgcttccgacccataattttaaaaggggccagtttgaagct
gcggaggaaatctgcggggagacccttgcggataagtacctgacccgcaacagtggctgt
gtaagctgtcccatacggtgtgagcggcgtgtgatggttgacgggcgcgaggtaaaaggg
ccggagtttgaaaccgtgggtctttttggctcaaatattgaaaacagcaatctggaattg
atcaatgagattaattataaagccgatattctgggattggatactatttccctggcgggt
acactggcctttgccatggaacttcaggaaagggaaatggcagactttggacttcgcttt
ggggaaaccggcaacctgctggagatcatcgaaaaaattgcgtatcgccaggacattggt
gacgagctggctgagggcagcgccaggctggcccaaaaatacggcggggcagattttgcc
atcaacgctaagggcatggaactggcatcttatgagccgcggcgctcagttggcatgggc
cttggctatgcgacctccaaccgcggaggctgtcatctgaacggcggctatctggcgctg
atggaatccgtgggtgtcatgagtgtcggtgcacagggaacaaagggaaagcctgagctt
accgcttttatgcagaacggcatggaagccggttcggcggcaggcttctgcctgttcacc
atgcagaccatgatcccgtcgattttgtatcatatgggaccagtcagcccggtaacccat
acggcaggaaaggctatgatcatggcccggggagttcttggaaatatgtggcctttgatg
ccgggactgctacctgttaaaaccatgtatctgatgccccactgcaaggccattgagctg
gctaccggtatgcgtatgacgaccggagagttccttcaagttggtgagcgcggttttacc
attgaacggctctttaatctgcgggaaggtttgactgctgagaatgacagcctgccaggc
cggctgacagacgaacttcaggaaccaactgatcccagcaccagggtagatctcgagaca
atgcttccggtatactacaaggtgaggggctgggatgagcgcggtgtgccaacatggcca
acgctcaagcgcctggggcttggaagcttatga

DBGET integrated database retrieval system