KEGG   Eubacterium limosum: ELI_0361Help
Entry
ELI_0361          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
elm  Eubacterium limosum
Pathway
elm00340  Histidine metabolism
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01230  Biosynthesis of amino acids
Module
elm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ELI_0361
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ELI_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADO35378
UniProt: E3GI93
Position
complement(337008..338294)
Genome map
AA seq 428 aa AA seqDB search
MKTYTYKESINKLDTLLKRDEGENQEIRRRVLEIIDTVKSQGDAALINYTEKFDGCRLDT
LRVTDAEIQEAFDLVGREMAAVIEEAAGNIRAFHEKQKEETWMYNPGPGITLGQHITPLE
RVGLYVPGGKAAYPSTVLMDSIPALVAGVDSLVMVTPPGKDGKINPNILAAAKIAGVHEI
YKAGGAQAVAALAYGTESIAPVNKIVGPGNIYVATAKKEVFGKVAIDMIAGPSEVLILAD
GTANPVYAAADLLSQAEHDEMAMPILVTTDADFGEKVITEVYRQIEADLGRKEIARKSVD
NYGFVFVAENLEQAFELSNAIAPEHMEILLPEPMQYLERVRNAGAIFLGSYTPEPLGDYF
AGPNHTLPTSGTAKFSSPLGVYDFMKKSSILSYSEDALEKVYTKIAAFARSEGLDAHAKS
VERRYENK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttacacatacaaagaaagcattaacaagctcgacacacttctcaagcgcgat
gagggcgagaatcaggaaatccgccgccgtgttctggaaatcatcgacaccgtcaaatcc
cagggtgacgcggcgcttataaactatactgaaaaatttgacggctgccgtctggatacc
ctgcgtgtgactgacgctgaaatccaggaggcttttgaccttgtaggacgggagatggcc
gctgtcattgaggaagccgcaggcaacatccgcgcttttcacgaaaagcaaaaggaggaa
acctggatgtataatcccggtccgggcattacccttgggcagcacattacgcctctggag
agagttggcctctatgtgcccggcggtaaggccgcgtatccctccacggtgcttatggac
agcatcccagcccttgtcgccggtgtagattccctggtcatggtaaccccaccgggaaaa
gacggaaagatcaacccaaatattctggccgctgccaaaattgcaggcgttcatgaaatt
tacaaggcaggcggcgcacaggcggtcgccgcactggcctacggcactgagagcatcgcc
cccgtcaacaaaattgtcggccctggcaatatctatgtggctaccgccaagaaagaggtc
tttggcaaagtcgccattgatatgatcgcagggcccagcgaggtattgatcctggccgat
ggaaccgccaatcctgtttacgccgccgctgatctgctttctcaggctgagcacgatgaa
atggccatgccgattctggtcactaccgacgccgattttggggaaaaagttatcactgag
gtttaccgccagattgaagctgacctggggcgcaaggaaattgcccgaaaatcggtggat
aattacggctttgtctttgtggcagaaaacctggagcaggcttttgaactctccaacgcc
atcgcgcctgaacatatggaaattcttcttcccgagccaatgcagtatctggaacgcgtc
cgcaacgccggcgctattttcctcggaagttataccccagagccgctgggagattatttt
gcaggaccaaaccatacgctgccgacctctggcaccgccaaattttcttcaccgcttggt
gtttacgactttatgaaaaaatccagcattctctcctattccgaggatgctctggaaaag
gtttatacaaagatcgctgcctttgcccgctccgaagggcttgacgcccatgcaaaatcc
gtggagcgccgctatgaaaataagtaa

DBGET integrated database retrieval system