KEGG   Eubacterium limosum: ELI_0361Help
Entry
ELI_0361          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
elm  Eubacterium limosum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:elm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:elm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(337008..338294)
Genome map
AA seq 428 aa AA seqDB search
MKTYTYKESINKLDTLLKRDEGENQEIRRRVLEIIDTVKSQGDAALINYTEKFDGCRLDT
LRVTDAEIQEAFDLVGREMAAVIEEAAGNIRAFHEKQKEETWMYNPGPGITLGQHITPLE
RVGLYVPGGKAAYPSTVLMDSIPALVAGVDSLVMVTPPGKDGKINPNILAAAKIAGVHEI
YKAGGAQAVAALAYGTESIAPVNKIVGPGNIYVATAKKEVFGKVAIDMIAGPSEVLILAD
GTANPVYAAADLLSQAEHDEMAMPILVTTDADFGEKVITEVYRQIEADLGRKEIARKSVD
NYGFVFVAENLEQAFELSNAIAPEHMEILLPEPMQYLERVRNAGAIFLGSYTPEPLGDYF
AGPNHTLPTSGTAKFSSPLGVYDFMKKSSILSYSEDALEKVYTKIAAFARSEGLDAHAKS
VERRYENK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttacacatacaaagaaagcattaacaagctcgacacacttctcaagcgcgat
gagggcgagaatcaggaaatccgccgccgtgttctggaaatcatcgacaccgtcaaatcc
cagggtgacgcggcgcttataaactatactgaaaaatttgacggctgccgtctggatacc
ctgcgtgtgactgacgctgaaatccaggaggcttttgaccttgtaggacgggagatggcc
gctgtcattgaggaagccgcaggcaacatccgcgcttttcacgaaaagcaaaaggaggaa
acctggatgtataatcccggtccgggcattacccttgggcagcacattacgcctctggag
agagttggcctctatgtgcccggcggtaaggccgcgtatccctccacggtgcttatggac
agcatcccagcccttgtcgccggtgtagattccctggtcatggtaaccccaccgggaaaa
gacggaaagatcaacccaaatattctggccgctgccaaaattgcaggcgttcatgaaatt
tacaaggcaggcggcgcacaggcggtcgccgcactggcctacggcactgagagcatcgcc
cccgtcaacaaaattgtcggccctggcaatatctatgtggctaccgccaagaaagaggtc
tttggcaaagtcgccattgatatgatcgcagggcccagcgaggtattgatcctggccgat
ggaaccgccaatcctgtttacgccgccgctgatctgctttctcaggctgagcacgatgaa
atggccatgccgattctggtcactaccgacgccgattttggggaaaaagttatcactgag
gtttaccgccagattgaagctgacctggggcgcaaggaaattgcccgaaaatcggtggat
aattacggctttgtctttgtggcagaaaacctggagcaggcttttgaactctccaacgcc
atcgcgcctgaacatatggaaattcttcttcccgagccaatgcagtatctggaacgcgtc
cgcaacgccggcgctattttcctcggaagttataccccagagccgctgggagattatttt
gcaggaccaaaccatacgctgccgacctctggcaccgccaaattttcttcaccgcttggt
gtttacgactttatgaaaaaatccagcattctctcctattccgaggatgctctggaaaag
gtttatacaaagatcgctgcctttgcccgctccgaagggcttgacgcccatgcaaaatcc
gtggagcgccgctatgaaaataagtaa

DBGET integrated database retrieval system