KEGG   Eubacterium limosum: ELI_0490Help
Entry
ELI_0490          CDS       T01336                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
elm  Eubacterium limosum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ELI_0490
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ELI_0490
Enzymes [BR:elm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ELI_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466766..468262
Genome map
AA seq 498 aa AA seqDB search
MIEVPMKLNCILEDPEIVEVRNNNPEIDIEHIAYNSQKVVPNSMFVAIRGLKTDGHKYIG
DAISRGAILVIYEHDLDEYQDDIMYVKVKNARHMLGTMSSRFYGHPSEALSITGVTGTNG
KTTITHMLKSIFQKDGRKCGLIGTINNQIGDEIIDNAGRTTPDSLEVQEIISEMVEAGCQ
NLVMEVSSHALDLDRVNGVAFDYGIFSNLTQDHLDYHKTFENYFEAKAKLFTYTSKANII
NCDDVWGKKLYDRCAQKKGVAVYSYGLNPECDFYARDMKYSIEGTRYTLVTKDGEEEIFI
SIPGEVMVYNSMAAIINALLEGISIEVIKEALASMSGVEGRMERLDLDTEFDIIIDYAHS
PDSLERLLKSVKTMYDGKVYLVFGCNGDRDKEKRPIMGRIAGEFADHVIVTSDNPASEDP
QSIIDTVAAAVAEKTDACETVLRRWDAIYYAATLPKAGDVLVLAGKGHEKQETMKDENLY
YNEWETAEEAVRRLKAGK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgattgaggtacccatgaaactaaattgtattttggaagatccagagattgtagaagta
cggaacaataatcccgagattgatattgaacatattgcctataattcccagaaggtagtc
ccgaacagcatgtttgtggctatcagaggactgaaaaccgatggacacaaatacattggc
gacgccatcagccggggcgccatcctggtaatctatgaacacgatctggatgaataccag
gatgatatcatgtatgtcaaggtaaaaaacgcccgccatatgctgggcactatgtccagc
cgtttttacggccatccgtcagaagcgctctctattaccggcgtgactggcaccaatgga
aaaaccacgattacccatatgctcaagagcatttttcaaaaggacggacgcaaatgcggc
ctgatcggcaccatcaacaaccagatcggggatgaaattatcgacaatgccggccgtacc
acgccagattcgctggaggtacaggagatcatctcggaaatggtagaagctggctgccaa
aacctggtgatggaggtctcgtctcacgcgctggatcttgaccgcgtcaacggtgtggcc
tttgattacggcattttttccaacctgacccaggaccacctggattaccacaaaaccttt
gaaaattattttgaagctaaggccaagctgtttacctatacttccaaggccaacatcatc
aactgtgacgatgtgtggggtaaaaagctgtatgaccgctgcgctcaaaagaagggtgtt
gctgtatactcctacgggctgaacccagaatgtgatttttacgcaagagatatgaagtac
agcatcgagggcacccgctacacgctggtgaccaaggacggcgaggaagaaatttttatt
tccatcccaggcgaggtcatggtttacaatagtatggccgccattatcaacgcactgctg
gaaggtatttccatcgaagtcatcaaggaagccctggcttccatgagcggcgtagagggc
cggatggagcgtctggatctggacactgaatttgatatcatcatcgattatgcccactca
ccggactctctggaacgcctgctgaaatctgtgaagaccatgtacgacggcaaggtttat
ctggtctttggctgtaatggggaccgcgataaggaaaaacgccccatcatgggccggatc
gccggcgagtttgccgaccatgtcatcgtgacctcagacaatccggccagcgaggaccca
cagtccattatcgacactgtggctgcagctgtggcggaaaaaaccgatgcctgcgagacc
gtgctgcgtcgctgggatgccatctactatgccgctaccctgccaaaagcgggtgatgtg
ctggtactggctggaaagggccacgaaaaacaggagaccatgaaggatgaaaacctgtat
tataacgaatgggaaaccgctgaggaagccgtgagacggctgaaagctggaaaataa

DBGET integrated database retrieval system