KEGG   Eubacterium limosum: ELI_0531Help
Entry
ELI_0531          CDS       T01336                                 

Definition
Ribulose-5-phosphate 4-epimerase-like epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
elm  Eubacterium limosum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ELI_0531
Enzymes [BR:elm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ELI_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510527..511180
Genome map
AA seq 217 aa AA seqDB search
MKYTEERQAIIDACLWLQDTGMVIGTWGNVSVRLDEETIMVTPSRIEYADLTPADMVIVD
MAGNKVEGEHKPTSEMHVHRLIYAARPDVGAVVHCHPVYASAMCAAEHGIPVIFEEMSQM
IGGEIPITAEYVNAGQHVRLGEVTAEALGDKNAVLIRNHAPVCVGRDLKEALTCSQVTEK
AAKCYLALRGGVEITTIPEAMVKAERHRFLYSYGHEQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatacggaagaaaggcaagccatcatcgacgcctgcctgtggcttcaggacacg
ggtatggtcattggtacctggggaaatgtgagcgtgcgcctggacgaagaaacgattatg
gtaactccgagccggatagaatatgcggacttgacgcctgcagatatggtgatcgtggat
atggcggggaacaaggtagagggcgaacacaaacctacctccgagatgcatgtgcaccgg
ctcatttacgcggcccgacccgatgtgggagcagtggttcactgccacccggtttacgcc
tcagccatgtgtgcggccgaacacggcattccggttatctttgaggaaatgagccagatg
atcgggggggagatccccatcacggccgagtatgtgaatgctggacagcatgtacgtctg
ggagaggtaaccgccgaggcactgggcgataaaaatgccgtcctgatccgcaatcacgcc
ccggtctgcgtgggccgtgatcttaaggaagccctgacttgttcacaggtgaccgagaaa
gctgccaagtgctatctggcgctcagaggcggtgtggagatcaccaccatcccggaggct
atggtcaaggccgagcgccataggttcctttacagctatggtcatgagcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system