KEGG   Eubacterium limosum: ELI_0772Help
Entry
ELI_0772          CDS       T01336                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
elm  Eubacterium limosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ELI_0772
Enzymes [BR:elm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ELI_0772
Exosome [BR:elm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ELI_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752585..753550
Genome map
AA seq 321 aa AA seqDB search
MLPTRLRKNAAVRDLIRETELSMRDVVYPLFVVDGENIKREIPSMKRQYHLSLDMLPKEL
DELKALGIRYIILFGVPDEKDAEATPAFVDDGIIQKAIRIVKEKDPEMYVITDVCLCEYK
SDGHCCFFHDNGDIKRDKSLETLCKVTVSHAKAGADMVAPSDMMDGHIESMRKALDDAGF
ESIPIMGYSAKFASTFYGPFRDAANSAPAFGDRRSYQMDPANSEEALKEVVLDIEEGADI
VMVKPAMPYLDIIAKAKELSYLPMAAYQVSGEYAMIRNAVDAGLLDEKAIYESMLCIKRA
GAKIIITYFAKDLKALIEKYQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgttaccaacccgattgagaaaaaacgcagcggttcgtgatctgatccgcgaaacagaa
ttatccatgcgcgatgtggtttacccgttgtttgtggttgacggggaaaatattaagcgt
gaaatcccgtccatgaagagacagtaccacctgtcgctcgatatgctgccaaaggaactg
gatgagctgaaggcgctgggtatccgttacattatcctgttcggcgtgccggatgaaaag
gacgcggaagcgacaccagcctttgtggacgacggcattatccagaaggccatccgcatt
gtcaaggaaaaagacccggaaatgtacgtcatcacggatgtctgcctctgcgaatacaag
agcgacggacactgctgctttttccacgataacggcgatatcaagcgtgacaaatcgctg
gaaaccctgtgtaaggtaaccgtgagccatgcgaaagccggcgcggatatggtagcgccc
tcagacatgatggacggccatatcgaatccatgcgtaaagcactggacgacgcaggcttt
gaaagcattccgattatgggctattctgccaaatttgcttctaccttctacggaccgttc
cgcgacgcggcaaattccgctccggcctttggcgaccgcagaagctatcagatggacccg
gctaacagcgaggaagcgctgaaggaagtcgtgctggatattgaggagggcgcagacatc
gtcatggtaaaacctgcaatgccttatttggatatcattgcaaaggccaaggaattgtct
tatctgccaatggcagcctaccaggtcagcggcgaatacgccatgatccggaatgcggtg
gacgccggcctcttagatgaaaaggccatttatgagagcatgctgtgcatcaaacgcgcg
ggagccaaaattattattacctatttcgcaaaagatttaaaagcgttgattgaaaaatat
cagtaa

DBGET integrated database retrieval system