KEGG   Eubacterium limosum: ELI_0912Help
Entry
ELI_0912          CDS       T01336                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
elm  Eubacterium limosum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ELI_0912
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ELI_0912
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ELI_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878315..878863
Genome map
AA seq 182 aa AA seqDB search
MKNIYDFRVEKMDGGKQALKDYEGKVLLVVNTASKCGFTPQFDGLEALYEKYKDQGLMIL
GFPCTQFANQDPGSNEEIENFCRLTYGVSFPMMAKIDVNGDNAEPLFVFLKEQQGFRGFD
LNTEKGKAFDERLSKDDPDYAQKSDIKWNFTKFLVDRDGNVVARYEPMVEPAALEKDIER
LL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatatatgactttcgtgttgaaaaaatggacggcggaaagcaggccctcaag
gattatgagggtaaggtgctgttagtggtcaataccgccagcaagtgcggctttaccccg
cagtttgacggcctcgaagccctttatgaaaagtataaggaccagggcctcatgatcctg
ggcttcccctgcacccagttcgccaaccaggacccgggcagcaatgaagagatcgaaaac
ttctgccgccttacctacggcgtatccttcccgatgatggcaaagattgatgtgaacggc
gacaacgccgaaccgctttttgtttttcttaaggaacaacagggcttcagagggtttgac
ttaaacaccgaaaagggcaaggcctttgacgagcgcctgtccaaggacgacccggattac
gcgcagaaaagcgatatcaaatggaattttaccaagtttcttgtcgaccgcgacggcaat
gtggttgcccgctatgagccgatggtagagcctgcagcgctggaaaaggacattgaaagg
cttttataa

DBGET integrated database retrieval system