KEGG   Eubacterium limosum: ELI_1016Help
Entry
ELI_1016          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
elm  Eubacterium limosum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ELI_1016
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ELI_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
966604..967497
Genome map
AA seq 297 aa AA seqDB search
MIVNFGSLNIDYVYSMEKIVRPGETLSSKERSVFPGGKGLNQSVALAHAGAEVRHAGFAG
SEDAQFLVDIMEASGVGTGLLQRVAETNGHAVIQVDEHGENCIILYRGTNGMPDSAYVEK
VGKTLHEGDLVLFQNETSAIAEMMRTAKEKRARIALNPSPMDNDCLNLPLELVDIFLLNE
IEGAALTGEKEPDKILSGLLKRFPKAKIVLTLGSEGAMFADSYKSFFQPVVECEKVVDTT
GAGDTFTGYYLAGIEAGMSDEEAIYRAATASSICITRMGAAPSIPLKEEVDTKAGIR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgaattttggctctttaaatattgattatgtctattccatggaaaaaatcgta
cgtccgggtgagacgctatcctcaaaggagcgttcggtttttccaggaggaaaggggctt
aaccagtctgtcgctttggcgcacgccggggctgaggtacgtcatgcgggattcgccggg
agcgaggacgctcaatttctggtcgatattatggaagcgagcggagtagggacagggctg
cttcagagggttgcggagacaaacggacatgcggttattcaggtggatgagcatggcgag
aattgtattatcttgtatcggggaaccaatggcatgccggacagtgcttatgttgagaag
gttggaaaaacacttcatgagggtgatctggttctgttccaaaacgagacaagtgctatt
gcggaaatgatgcggacggcaaaagagaagagggccagaattgcattgaatccatctccg
atggataatgactgcctgaatctgccgctggagctggtggatatttttctgctcaatgag
attgagggagcggcactgacgggagaaaaagagcccgataaaatcctctcagggctactt
aaacgtttcccaaaagcaaaaattgttttaactcttggaagtgaaggggcaatgtttgcg
gattcatataaaagttttttccagcccgtggtggaatgcgaaaaagtggtggatacgacg
ggcgcgggagatacgtttactggttactatctggctggaattgaagcgggaatgagtgat
gaagaggcaatttacagagcggcgactgcctcatccatttgtattacccgaatgggtgct
gcgccgtcaatccctttgaaagaagaggtggatacgaaagcaggtatacgctga

DBGET integrated database retrieval system