KEGG   Eubacterium limosum: ELI_1112Help
Entry
ELI_1112          CDS       T01336                                 

Definition
aspartate aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
elm  Eubacterium limosum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    ELI_1112
   01230 Biosynthesis of amino acids
    ELI_1112
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ELI_1112
   00290 Valine, leucine and isoleucine biosynthesis
    ELI_1112
Enzymes [BR:elm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ELI_1112
    2.6.1.66  valine---pyruvate transaminase
     ELI_1112
Amino acid related enzymes [BR:elm01007]
 Aminotransferase (transaminase)
  Class I
   ELI_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1061149..1062366
Genome map
AA seq 405 aa AA seqDB search
MRTFKKSKKLDNVCYDIRGPVVEEADRMTAEGIDIIMLNTGNPPTFNLNAPDEVIRDIRY
NLRSSEAYCHSKGIFPARKAIVQYYQTKGLMDLNEEDVYIGNGSSELVSFCMQALVDDGD
EILIPAPDYPLWTACATLAGGRAVHYICDEESNWYPDLEDIRKKITPNTKGIVVINPNNP
TGAVYPREILEGIVKIAVENELIIFSDEIYDQIIYDEIEHVPMGTLTDETLVVTLNGLSK
SHRVPGFRVGWMVFSGNREMARDYIEGINLLATMRLCANVPAQYAIQTSLGGYQSIDDLV
RPGGRLYEQRNIVYKRLNEIPGISCVKPDGALYCFPKIDIKRFNITDDVQFALDFLKRER
VLLVQGTGFNWAEPDHFRVVFLPAPTQLEETMDRLQRFMGGYIQG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttttaaaaaatccaaaaagctggacaacgtctgttatgatatccgcggaccg
gtcgtagaggaagcagacaggatgacggcggaggggattgacatcatcatgctcaatact
ggaaatccgccgaccttcaacctgaacgctccggacgaggttatccgtgatattcgctat
aacctcagaagctctgaggcttattgccactccaaggggattttcccggcacgaaaagcc
attgtgcagtattatcagacaaagggacttatggacctgaatgaggaggatgtgtatatc
ggaaacggctccagtgagctggtctctttctgtatgcaggcactggtggacgacggcgat
gagattttaatcccggcgccggattatccgctctggaccgcctgcgccactctggcaggg
ggcagggctgtccactatatctgtgacgaggagtccaactggtatccggatctcgaggat
attcgaaagaagattacgcccaacaccaagggaattgtcgttatcaaccccaacaacccc
acgggggctgtttatccgagggaaatccttgagggaattgtcaagattgcggttgaaaat
gagctgatcattttttccgatgagatttatgaccagatcatttacgatgaaatcgagcat
gtgcctatgggaacccttactgatgaaaccctggtggtcaccctcaatgggctgtcaaaa
tcccaccgtgttccgggcttcagagttggatggatggttttttcaggaaacagggaaatg
gccagagactatatcgagggtatcaatcttctggcaaccatgcgtctgtgtgccaatgtt
ccggcccagtacgctatccagacctccctcggcggatatcagagtatcgacgacctggtg
cgtccggggggacgtctttacgagcagcgcaacattgtttacaagcggctcaacgagatc
ccgggtatcagctgtgtcaagcctgacggcgcgctgtactgtttcccgaagattgacatc
aaacgcttcaacatcacagacgacgttcagtttgccctggatttcctcaaaagggaacgc
gtgttgctggtacagggcacaggctttaactgggccgagcccgaccatttcagagtggtt
tttctgccagcgcccacacagcttgaagaaaccatggaccgccttcagcgcttcatgggc
ggttatatacaaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system