KEGG   Eubacterium limosum: ELI_1124Help
Entry
ELI_1124          CDS       T01336                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elm  Eubacterium limosum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:elm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:elm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:elm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:elm00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072391..1074268
Genome map
AA seq 625 aa AA seqDB search
MAADIILPKLGMDMQSGTIMTWYKNEGDTVKKGEPLFELMTDKVNIEVEAEDNGVLLKRY
YETGVELPVFTVIGCIGEAGEQVPEHQTVSLRGNMQSPGHLTDEDRAALKAMRSSTREGF
SSAGKTIRATPSARRLAAEHKIDLANVAGSGPKGRIQVEDIEALLEVSKKVEKTEVPQQK
VFTEPEEKKIEASSVPEETNELADEPESIVAEETEEAFTAEPNPGMTGALDMTLEDLVAG
MGSLEAELGSEAHEEDVMEGAAQKAETEAEEGPHAISASPLAEKIAAVENIDIHSIPEGS
GPDGRIMKEDVLKAMAEGSIRHESVIEEVEVQERAPEEEETTEEPILAEPEPKPEKQKEQ
SEPDNRDEEESIVVTGPEPTTPVSEEAKGAADKPPVNGRLEAMPSKRRIIADRMVKSNLE
NAVITLTTEVDMTEVKDLRKKISKKVEKETGYRCTYTDFLLVSVSRALMEHPYINSSLCE
DGVVLHDFVNLGMAVGMDDGLIVPVIRDAHAASFSEMVEKRSELLKLVKAKKLTGDHFKD
STFTVTNLGMYGILEFTAIINQPNSAILSVGEVVDRVRIFKGEPTPRSIMKISLNLDHRV
ADGMAGAKFLQTVKSYMENPALLLF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatattattttaccaaagctaggaatggacatgcagtccggaaccataatg
acatggtataaaaacgagggagacaccgtcaaaaaaggtgaaccgctgtttgagctcatg
accgataaagtcaatatcgaggttgaggccgaggataatggtgtccttctgaaacgctac
tatgaaacaggcgtggaactaccggtatttacagtcatcggctgtatcggtgaggctgga
gaacaggtgccggagcatcagacggtttcgctgcgcggcaatatgcagagcccgggccac
ctcacagatgaggaccgcgcagcgctgaaggccatgcgcagctctacccgcgagggattt
tcaagcgcgggcaaaaccatacgcgccacaccgtccgccagacgtttggcggcagagcat
aagattgatctggcaaacgtagctggcagcggccctaaagggcgtattcaggtagaggat
atcgaggcattgctggaagtatccaaaaaagtagagaaaaccgaggtgcctcagcaaaaa
gtctttactgaaccagaggaaaaaaagattgaggcatcaagcgttccagaggaaaccaat
gagttggctgacgaaccggaaagcattgtggctgaagaaaccgaagaagcctttaccgca
gagccgaatccgggaatgaccggagcccttgatatgacccttgaggacctggtagctggg
atgggcagccttgaagccgagctgggcagcgaagcccatgaggaggatgtcatggagggt
gctgctcaaaaggcggaaacagaggcagaagaagggccacatgcaatcagtgcgtcaccg
ctggccgaaaaaatagcggcggtcgaaaatattgacattcacagtattcccgagggcagc
ggtccggacggacgcatcatgaaggaggatgtcctgaaagccatggccgaaggatcaatc
cgccatgaaagcgtgattgaggaggttgaggttcaggagagagcacctgaggaagaggaa
accaccgaagaacccatcctggcagaaccggagccgaagcctgaaaaacagaaagaacag
tcagagcccgacaatagagatgaagaagagagcattgtcgtcacaggccctgagccaacc
accccggtgtctgaggaagcaaaaggagcagctgataaaccgccggtaaacggcagactt
gaagccatgccgtcaaaacgcagaattattgcggaccgcatggtaaagagcaatcttgaa
aacgcagtgatcaccctgacaacagaggtagatatgaccgaggttaaggacctgcgcaag
aaaatcagcaaaaaagttgagaaggaaacaggctatcgctgtacctatacggatttcctg
ctggtttccgtttcaagagccttaatggagcatccctatatcaacagcagtctgtgtgag
gacggcgttgtgctgcatgattttgtaaatctgggcatggctgtgggaatggatgatggc
ctgatcgtccctgttatccgcgacgcccatgccgcaagtttttccgaaatggtcgaaaaa
cgcagcgagctgctcaagcttgtcaaggcgaaaaaactgacaggcgaccattttaaggac
agcacttttacagtaaccaatctgggcatgtatggtatcctggaattcacagctattatc
aaccagcccaacagcgcgattctgagcgtgggcgaggtggtagacagggttcgtatcttc
aaaggcgagccgactccgagatctataatgaagatcagtctgaatctggatcaccgcgtg
gcagacggcatggcaggagccaaattcctccagactgtcaagagctatatggaaaacccg
gccctgctgttattttga

DBGET integrated database retrieval system