KEGG   Eubacterium limosum: ELI_1159Help
Entry
ELI_1159          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
elm  Eubacterium limosum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:elm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ELI_1159
Enzymes [BR:elm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ELI_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108602..1110812
Genome map
AA seq 736 aa AA seqDB search
METLKGTVDHIIFHNDKNGYTVADFDVDGQMVTVVGNFEELKEGEFLKLTGFWKEHQSYG
EQFQIESYALDLPTSEEGIIRYLSSGLLPGIGEKTAIEIVNHFGADTLDILDNHPDRLSE
VHGIGKKTLDKIKEVYSEQKEIRDVMIQIQEYGISSTYAMKLYKTYQSDTVRVLLDNPYQ
IIKDVRGIGFKIADQISAQLGFESQNPKRILSGISFCLQDCYSRGNTYMTEKDLIEHSAS
ILGVSREDIEFQLQELALRGDVRLEFIDDEPAYYPSALFEAEDNAALSMVRLAGAVFEMQ
EVDIPAMIAAYEEDMSIRLDNRQAEAIEAAIENGIAIITGGPGTGKTTIINGIVYIFKRL
GMKTVLAAPTGRAAKRITETTGEQAKTIHRLLEYDYSGDDDFPSFNRDEENPLEADAIIL
DEASMIDIVLLNSLLEAIRPGTRLILVGDADQLPSVGPGNVLQDLIESNVVKVVRLDRIY
RQSEESMISINAHAINEGMMPEINNQSDFMFIRTMDPDKVLDTILDLVAWRIPEKKGFDA
MKDVQVISPIKKGKLGVISLNKELQEVLNPAADYKKEKTFGTVVFREGDKVMQIKNNYKL
KWEDIHGFETGEGVYNGDIGNIIRIDEYNKTFEILLTDDKKVVYEFDQLDELTHAYAMTV
HKSQGSEFPVVIMPMVGGPPMFLNRKLLYTAVTRAKKMLMLIGPQNYFYRMVKSGDTNER
RTALKQRIKMYGELNV
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggagaccttaaaaggaacagtagatcatattattttccataatgacaaaaacggttat
accgtagcggattttgatgtggacggccaaatggtaacggtcgttggcaattttgaggag
ctgaaggagggcgaatttttaaagctgaccggcttctggaaggagcaccagagctatggc
gagcagtttcagatcgagagctatgcgctggatctcccgacctctgaggaaggcatcatc
cgttatctgagttcaggactcctgccgggtattggcgaaaagaccgctattgagatcgta
aaccattttggagccgacacgctggatatcctggacaaccatccagaccggctgagcgag
gttcacggcatcggcaaaaagacactcgacaaaataaaagaggtttacagtgaacagaag
gaaatccgggatgtcatgatccagatccaggaatatggcatttcctcgacctatgccatg
aagctgtataaaacctatcagagtgatacggtgcgtgttcttttggataacccctaccaa
atcatcaaggatgtgcgcggcattggctttaaaatagcagaccagatttccgctcagctg
ggttttgagtcccagaaccctaagcggattctctcgggcatcagcttctgccttcaggac
tgttactcaaggggcaacacctacatgaccgaaaaagaccttattgagcacagcgccagt
atcctcggggtttcaagggaggacattgaatttcagcttcaggagctggccctgcgggga
gacgtacgcctagagttcatcgacgacgagccagcctactatccttcagccctttttgag
gcagaggacaatgccgccctgtccatggtacgcctggctggcgcagtctttgagatgcag
gaagttgatataccagccatgatcgcagcctatgaggaggatatgagcattcgtctggat
aaccggcaggcagaggccattgaggcggccatcgaaaatggcatcgccattattacaggg
ggaccaggcacagggaaaacaacgattatcaacggtatcgtctacatttttaagcgtctt
ggcatgaaaactgttctggctgcccccacaggccgcgccgccaagcgcatcacagaaaca
accggtgagcaagccaagaccatccaccggcttttggagtatgactattctggtgacgat
gattttccatcctttaacagggacgaggaaaacccgcttgaggctgacgccatcattctg
gatgaagcctctatgattgatattgtgctgctcaacagcctgctggaggccatcaggccc
ggcacgcgcctcattctggtaggcgacgccgaccagctgccctccgttggaccgggaaac
gtcttacaggacctgatcgagagcaacgtggtcaaggttgtgcgtctggaccgtatctac
cgtcagtcggaggaaagcatgatctccataaacgctcatgccattaatgagggtatgatg
ccggaaatcaataaccagtctgactttatgtttataaggacaatggaccccgataaggtg
ctggataccattttggatctggttgcctggcgtattcctgaaaaaaaaggctttgacgcc
atgaaggatgttcaggtcatctcacccattaaaaaaggaaagctcggcgttatttcgctg
aataaggagctccaggaggttctgaacccagcggcagactataaaaaggaaaagaccttt
ggtacagtggtgttccgcgagggggacaaggtcatgcagattaaaaacaattataagctc
aagtgggaggatatccacggctttgaaaccggagagggtgtttataacggcgatatcggc
aacatcatccgcattgatgagtacaataaaacctttgaaatcctgctgacagatgacaaa
aaagtcgtttatgagtttgaccagctcgacgagctcacccatgcctatgccatgactgtt
cacaaaagccaggggagtgaatttccagttgttatcatgccgatggtaggcggaccgcct
atgtttttaaaccggaagctgctgtacacagcagtgaccagagccaaaaagatgctgatg
cttatcgggcctcagaattatttttaccggatggtcaaatccggagataccaatgaacgg
cggacagccctcaaacagcggatcaaaatgtatggagagctcaatgtctga

DBGET integrated database retrieval system