KEGG   Eubacterium limosum: ELI_1665Help
Entry
ELI_1665          CDS       T01336                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
elm  Eubacterium limosum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_1665
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_1665
Enzymes [BR:elm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ELI_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1572744..1573532
Genome map
AA seq 262 aa AA seqDB search
MILDKLAASARVRVDRLKGERPLESVREEALSIKPEKPFCFEKALKKEDIAFICEVKKAS
PSKGLIAPDFPYVHIARDYEAAGADAISVLTEPQYFLGSDDYLSAVKRAVSIPVIRKDFT
IDPYQIYEARIIGADAVLLICALLDTEALTEYIRIADRLGLSALVEAHDAAEVCSALEAG
ARVIGVNNRNLKTFEVDIENSARLRQLVPEHITFVSESGIKTPGDIDALRKNGTDAVLIG
ETLMRSSRKAEELARLRGERLA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagataaattagcggccagcgccagggtacgggtcgaccggttaaagggagag
cggcctttggaaagcgtaagagaggaagccctgtccataaagcccgaaaagcccttttgc
tttgaaaaggcgttaaaaaaagaggacattgcttttatctgtgaggtcaagaaagcgtcc
ccctcaaaggggcttatcgctccggattttccctatgtgcatatcgccagagattacgag
gctgccggcgcagacgcgatctcagtcctcaccgagccccaatactttttaggcagtgac
gattatctgagcgctgtcaagagggcggtgagcattccggttatccgaaaggattttacc
attgacccctatcagatttacgaggccagaatcatcggggcagacgctgttttgctgatc
tgcgcgctccttgacacagaagccctgacggaatatatccgcattgccgacagactgggc
ctgtccgccctggtggaggcccacgacgcggcagaggtctgctcggcccttgaggcaggc
gcccgggtgatcggcgtcaacaaccggaaccttaaaacctttgaggtcgacatcgaaaac
agtgcgcgactcaggcagctggtgccagagcatatcacttttgtctctgaaagcggcatt
aaaacccccggggatattgacgcgctcaggaaaaacggcaccgacgcagtgctcatcggt
gagactctgatgcgcagcagccgcaaggcggaggagctggcaagattgcggggagagcgt
ctggcatga

DBGET integrated database retrieval system