KEGG   Eubacterium limosum: ELI_1667Help
Entry
ELI_1667          CDS       T01336                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elm  Eubacterium limosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_1667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_1667
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_1667
Enzymes [BR:elm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ELI_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1574155..1575339
Genome map
AA seq 394 aa AA seqDB search
MTKGRYGQHGGQYIPETLMNAVIELEEAYEHYKKDPAFNAELNDLLKNYAGRPSLLYYAE
KMTRDLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKKMGKTRVIAETGAGQHGVATATA
AALMDMECEIFMGKEDTDRQALNVYRMELLGAKVHAVTSGTMTLKDAVNETMREWTSRII
DTHYVLGSVMGPHPFPMMVRDFQSVISREAREQILEREGKLPAAVLACVGGGSNAMGMFY
HFIEDRDVRLIGCEAAGKGVDTDKHAATIAKGTPGIFHGMKSYFCQDVYGQIAPVYSISA
GLDYPGIGPEHAHLHDLGRAEYVPVTDDEAISAFEYLSRTEGIIPAVESAHAVAYARKLA
PSMSADESIIICLSGRGDKDVAAIARYKGVDLHE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggacgctacggacagcacgggggccagtatatccctgagacattaatgaac
gcggtgattgagctcgaggaggcctacgagcattataaaaaggacccggccttcaatgcc
gagctgaatgacctgctgaaaaattacgcaggccgcccttcattactatactatgcagaa
aaaatgacaagggatcttggaggcgcaaagatttatctgaagcgtgaggacctgaaccat
acaggctcacataaaattaacaatgtgctggggcaggtgcttctggcaaagaaaatgggc
aaaacccgcgtgatcgcagagacaggggccgggcagcacggtgtcgccaccgccaccgcc
gcggcgctcatggatatggaatgtgaaatcttcatggggaaggaggacaccgaccgccag
gctctgaatgtttaccggatggagctgctcggcgcaaaggtccacgcggtgaccagcggc
accatgactttaaaggacgccgtcaatgaaaccatgcgggaatggaccagccggatcatt
gatacccactatgtgctgggctcagtgatgggaccgcacccctttcccatgatggtgcgc
gattttcagtctgtgatcagcagagaggccagagagcagattctggaaagagaaggaaaa
ctgcccgcggcagttctggcctgtgtgggcggcggcagcaacgccatggggatgttttac
cattttatagaagatcgggatgtgcggctcatcggctgtgaggcggcaggaaagggcgtg
gacaccgacaaacacgcagccaccatcgccaagggcacacccggcatttttcacggcatg
aaatcctatttctgtcaggatgtctacggccagatcgccccggtatactccatctcagcc
gggctggattatcccggtatcggcccggagcacgctcacctgcacgatcttggcagggcg
gagtatgtgccagtcaccgatgacgaggccatcagcgcctttgaatacctctcgcggaca
gaagggattatcccggcagttgagagcgctcacgctgtcgcttacgccagaaagctggcg
ccgtccatgtcagcggatgagagcatcattatctgtttatcgggccgcggagataaggac
gtggcagccatcgcacgttataagggggtagatttacatgagtaa

DBGET integrated database retrieval system