KEGG   Eubacterium limosum: ELI_2059Help
Entry
ELI_2059          CDS       T01336                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
elm  Eubacterium limosum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ELI_2059
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ELI_2059
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ELI_2059
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ELI_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1920073..1920909
Genome map
AA seq 278 aa AA seqDB search
MRQTIKEAETIVIKMGTTSVTHANGTLNLKKLDQLARVLTDLENSGRKMVLVSSGAIGCG
MNRLGLKERPKTLEAKQATASVGQGLLMEIYHKFFDEYHQNVGQILLTKDVFKHSIKRNN
AINTFKALKNRSIIPIVNENDCIATDEIQEECFGDNDILSAMTADIVDADLLIILSDVDG
LYDSNPNENEDARLLQTVETIDSDILSSAGCSTSGLGTGGMVTKIGAAKYATDRGIDTII
ASGEDVKVIYDILEGNEIGTFFIKQDLQEVQNVKKSND
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagacaattaaggaagcagagaccattgtcataaaaatgggaaccacctcggta
acccatgccaatggtaccctcaatttaaaaaagcttgatcagctggcaagggttttgaca
gatcttgaaaacagtgggagaaagatggttttggtatcttcgggtgccatcggctgtgga
atgaaccgcttagggttaaaggaacggccaaagacactggaggctaaacaggccaccgct
tcggtaggacaaggacttttgatggagatctaccataagttttttgacgaataccaccag
aatgtggggcagatcctgctgactaaagatgtgtttaagcattctattaaaagaaacaat
gccatcaacaccttcaaggcgctcaaaaaccgcagcatcatcccaatcgtcaatgaaaat
gactgtatcgctacggatgaaattcaggaggagtgttttggggataatgatattctgtct
gccatgactgccgatattgtggatgctgaccttttgattattctctcagacgtggatggg
ctgtacgactcaaatcccaatgaaaatgaggatgccagactgctccagaccgttgagacg
attgattccgatattttgagcagtgcgggatgttctacctccggccttggaacaggcggc
atggtgactaaaatcggagcggcaaaatacgccacagatcgcggaatcgacacgatcatc
gcatccggtgaggatgtcaaagtgatttatgatattttagaaggcaatgaaataggaaca
ttttttattaaacaggatttacaggaggtccaaaatgttaaaaaaagtaatgattag

DBGET integrated database retrieval system