KEGG   Eubacterium limosum: ELI_2455Help
Entry
ELI_2455          CDS       T01336                                 

Definition
glutaminase GlsA
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
elm  Eubacterium limosum
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:elm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:elm00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:elm00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2274324..2275265
Genome map
AA seq 313 aa AA seqDB search
MQKNIIDTKKLEAVLKQAHSTAESDQSGANASYIPALAKVPSNLFGLTAVTADGTVLETG
DSSYPFAIESISKVFSMALVMEAVGAQEMLKKVGADPTGLPFNSVMALELHRGKPLSPLV
NAGAMATVSLLPAANADEKWQKILDGYSQFAGHSLEVMDAVYTSEAATNSHNKGIAWLMS
SYGTLYDDPDTTCDIYTKQCSIAITCKDLAVMGSTLANGGVNPITGKAIINPEFLPHIFA
EMTMEGLYGASGDFAYTVGLPGKSGVGGGLLAVVPGQLALSAFSPRLDPIGNSVRGQKAM
RFISDALDLSLYR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaacattattgatactaagaaacttgaagctgttctcaagcaggctcacagc
accgcagaaagtgatcagtctggcgccaacgcttcctatattcctgctctggcaaaggtt
ccatcaaatctgtttgggctgaccgctgtaacagcagatggcacagtccttgagacaggc
gacagcagctatccttttgccattgaatccatctccaaggtcttttccatggcgcttgtc
atggaagctgtcggcgctcaagaaatgttaaaaaaggtaggcgcagacccgacaggactt
ccctttaactctgtaatggcactggagctgcaccggggcaagccgctttcaccactggta
aacgctggcgctatggccactgtcagcctgctgccagccgccaatgccgatgaaaaatgg
cagaaaattctggatggttacagtcagtttgccggccacagcctcgaagtgatggacgct
gtatatacctccgaagctgccaccaacagtcataataaaggcattgcctggctcatgtca
agctacggcacgctttatgacgatccagataccacctgcgatatttatacaaagcaatgc
tctatcgccataacctgtaaggatctggcggttatgggttctacactagccaatggcggt
gtaaatccaatcactggaaaagccataataaatcctgaatttttacctcatatttttgcc
gagatgaccatggaaggtctctatggtgcttccggcgatttcgcctataccgtagggctt
cctgggaaaagcggtgtaggtggaggcctgctggcggtagtgcccggacagctggcgctc
tctgctttcagtcccaggcttgacccgattggcaacagtgttcgagggcaaaaagccatg
cgttttatatcagacgcgctcgatctttcactttaccggtaa

DBGET integrated database retrieval system