KEGG   Eubacterium limosum: ELI_2787Help
Entry
ELI_2787          CDS       T01336                                 

Definition
(RefSeq) hypothetical protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
elm  Eubacterium limosum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_2787
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_2787
   00020 Citrate cycle (TCA cycle)
    ELI_2787
   00620 Pyruvate metabolism
    ELI_2787
   00640 Propanoate metabolism
    ELI_2787
   00650 Butanoate metabolism
    ELI_2787
  Energy metabolism
   00680 Methane metabolism
    ELI_2787
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ELI_2787
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ELI_2787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2587966..2588898)
Genome map
AA seq 310 aa AA seqDB search
MSYNFKETMNKEERLAPGHRMCAGCGGTIAVRNVLRGLHEGDEAVITCATGCLEVSSFMY
PFTAWKDSFIHNAFENAAATCSGVESAYRALKKKGKVQENYKFITFGGDGGTYDIGFQSL
SGAMERNHDMVYVCYDNEAYMNTGIQRSSATPMYADTTTSPVGRESDGKEQNRKDLTEVL
AAHDIPYAAQTTFIRNFKDLHTKAEKAIYTKGAAFLNVLAPCPRGWRYNTPDIMDICKMA
VETCYWPLYEVIEGKWILNYEPKKKLPIEDFLKVQGRFKHLFKKENEGLIEKMQKEVDRK
WEALQKRCDA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtataattttaaagaaacgatgaataaagaggaacgactggcaccaggccacaga
atgtgtgccggctgcggcggaacaatcgcggttcggaatgtcctgcgcggcctgcacgaa
ggcgatgaagcagtgatcacctgcgccacgggatgtctggaggtatcttctttcatgtat
cccttcacagcgtggaaggactcctttatccataatgcctttgaaaacgccgctgccacc
tgcagcggtgtggaatctgcataccgtgccttaaagaaaaaaggaaaggtacaggaaaat
tataaattcatcacttttggcggtgacggcggtacctacgatattggttttcagtctctt
tcaggcgcaatggagagaaaccacgacatggtttacgtctgctatgataacgaagcctac
atgaatacaggaatccagcgctcctcagcaacgcccatgtacgcagacaccaccacaagc
cctgtcggccgagaatcagacggcaaggagcagaatcgaaaagatttaaccgaggtgctc
gccgcccacgacatcccctatgcggcccagaccacctttatccggaattttaaggatctt
catacaaaggcagaaaaagcgatctatacaaaaggcgcggcctttttaaatgtcctcgcg
ccctgtccgcggggctggcgttacaacacgccggatatcatggatatctgtaagatggcg
gtcgagacctgctactggccgctttatgaggtgattgaaggaaaatggatactcaattat
gagccaaagaaaaaactgcccattgaagatttcttaaaagttcagggccgcttcaagcat
ttatttaaaaaagaaaatgaaggactcattgaaaaaatgcaaaaagaagtcgaccgtaag
tgggaagcacttcagaaaagatgtgacgcttaa

DBGET integrated database retrieval system