KEGG   Eubacterium limosum: ELI_2805Help
Entry
ELI_2805          CDS       T01336                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
elm  Eubacterium limosum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ELI_2805
   01230 Biosynthesis of amino acids
    ELI_2805
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_2805
  Energy metabolism
   00680 Methane metabolism
    ELI_2805
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ELI_2805
Enzymes [BR:elm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ELI_2805
Exosome [BR:elm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ELI_2805
  Exosomal proteins of melanoma cells
   ELI_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2603918..2604727)
Genome map
AA seq 269 aa AA seqDB search
MKNMQFPEIFGYKILKELEMIKMKLVLLRHGESEWNRLNLFTGWTDVILSNKGIKEAADA
GNMLKGKDYDFDICYTSFLKRAVDTLNVVLDTMDRAWLPVIKDWKLNERHYGALQGLNKA
ETAEKYGEEQVKIWRRSFDVRPPALEPDDPRNPQLQEQYRNVEKSELPLAESLKDTITRV
IPYYENVIKKDMLEGKRVLLVAHGNSIRALVKYFENLSEDEIMGVNIPTGIPLIYEFDDD
FNMTDHYYLGDQSIIETRMKKVAEQGKAK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatgcaatttccagaaatttttgggtataaaattttaaaagaactggagatg
ataaagatgaagcttgtacttttaagacatggtgaaagtgaatggaaccgcctgaacctg
tttacaggatggacggacgtaattttatcgaataaaggtattaaagaagccgcagacgct
ggcaatatgctaaaaggaaaggactacgattttgatatctgttacacctcttttttaaaa
agagcggtggataccttaaacgtggttttggataccatggaccgggcctggctgccagtc
ataaaggactggaagcttaacgaacgccattatggcgccttgcaagggctgaataaggcc
gagacagcagagaaatacggagaggaacaggtcaaaatctggcgccgatcctttgacgtc
cgtccaccggctctggaaccggatgaccccagaaacccacagctgcaggagcagtatcga
aatgtggaaaaaagcgagctgcctttggcagaaagcctgaaggatacgatcactcgcgtt
atcccttattatgaaaatgtgataaaaaaggatatgcttgagggcaaacgcgttctgctg
gtagcccacggaaactcgatccgcgcgctggttaaatattttgaaaacctgtcggaggat
gagatcatgggtgtcaatatcccaaccggtattcctttgatttatgaattcgacgatgac
tttaatatgactgaccattactacctgggagaccaatccattattgaaacacgaatgaaa
aaagtggctgagcagggaaaagcaaaataa

DBGET integrated database retrieval system