KEGG   Eubacterium limosum: ELI_2868Help
Entry
ELI_2868          CDS       T01336                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
elm  Eubacterium limosum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ELI_2868
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ELI_2868
Exosome [BR:elm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ELI_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2664846..2666330)
Genome map
AA seq 494 aa AA seqDB search
MSKYILVMDQGTTGSRGIVYNEQGKAIALDYEEYEQFFPQSGWWDQSGLTVWNVTLKTAR
NAIKKAGLEGKDIAAIGITNQRETTTLWDKNTGVPVHNSIVWGCRRTTEICQGLIEKGCN
DMVNKKTGLVIDPTYSATKIRWVLDNVPAAQEKAENGDLLFGTIDSWLLWNLTKGKVHAT
DYSNAARTMVFNSYELKWDDELMDMLDLPWKIFPEVKESVGLFGYADPEWFGAEIPITGI
AGDQSAALFGQACFEEGTAKNTYGTSAVPLMFTGDKAPETEKGLLTVAWGKDGKVKYSMG
ASILIAGQVIQWLRDKVNICEKAADTEAMAESIPDNGGLYFVPAFTGLGAPHWNMNARGM
MIGITAATTKEQMARAALESMAYQTRDLLEEMERNSGVKLKELKVDGGAAQNDFLMQFQA
DILNCNVIRPKDIETTALGACYLAGLGCGIFENEDQIKALWEADRVFTPQMDEATREALY
SQWCKAVEKSKDWL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtatattttggttatggaccagggaaccactggttcaagggggattgtttac
aacgaacaggggaaggccatcgcgctggattacgaagaatacgaacagttttttccgcag
tccggatggtgggaccagagcggtctgaccgtctggaatgtgactttgaaaaccgcgcgc
aacgccattaaaaaggctggcctggaaggaaaagacatcgcagccatcggcatcaccaac
cagcgtgaaaccaccactctgtgggataagaacactggcgtgcctgtgcacaattccatc
gtctggggctgccgccgtaccaccgaaatctgccagggtctgatcgaaaaaggctgcaac
gacatggtcaataagaagacgggtcttgtaatcgaccccacctactcggctaccaagatc
cgctgggtcttagacaatgttccggccgcccaagaaaaagctgaaaacggagacctgctc
ttcggcaccattgattcctggctgctgtggaacctgacaaagggtaaggtacacgccacc
gattactccaatgctgccagaaccatggtctttaattcctatgaactgaaatgggacgac
gagcttatggacatgctggatctgccctggaagatcttcccagaagtcaaggaatccgta
gggcttttcggctatgccgatcctgaatggtttggcgcagaaatcccaatcaccggtatt
gccggtgaccagtccgcagccctgtttggacaggcctgttttgaagaaggaaccgcgaaa
aatacttacggcaccagcgcagtgccgcttatgtttaccggcgacaaagcaccggaaacc
gaaaaaggcctgctgaccgttgcctggggtaaggacggcaaggtaaaatattccatgggc
gccagcatccttatcgccggacaggttattcagtggctgcgcgataaggtcaatatctgc
gaaaaggcagcggacaccgaagccatggccgaaagcattccggacaatggcggcctgtat
tttgtacctgccttcaccgggctgggcgcgccgcactggaacatgaacgcccgcggcatg
atgatcggcatcaccgccgccaccaccaaggaacagatggcccgcgcggccctcgagtcc
atggcctaccagactcgtgacctgctcgaagaaatggaacggaactccggcgtcaagctc
aaagagctcaaagttgacggcggcgctgcccagaacgatttcctcatgcagtttcaggcc
gatatcctgaactgtaacgttataagaccaaaggatattgaaaccaccgcccttggcgct
tgttaccttgccggcctcggctgcggcatcttcgaaaacgaagaccagatcaaagccctg
tgggaagccgaccgcgtcttcaccccgcagatggacgaagcgacaagagaagccctgtac
agccagtggtgcaaagccgtcgaaaaatcaaaagactggttataa

DBGET integrated database retrieval system